KEGG   Pantoea ananatis AJ13355: PAJ_1752
Entry
PAJ_1752          CDS       T01969                                 

Gene name
ygbN
Definition
(GenBank) inner membrane permease YgbN
  KO
K03299  gluconate:H+ symporter, GntP family
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paj02000]
    PAJ_1752 (ygbN)
Transporters [BR:paj02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   PAJ_1752 (ygbN)
SSDB
Motif
Pfam: GntP_permease CitMHS
Other DBs
NCBI-ProteinID: BAK11832
UniProt: A0A0H3L4R9
Position
complement(2118233..2119588)
AA seq 451 aa
MTTALLLAIATASIVILLLLVIKAKVHPFVALLIVSLLVAIATGIPAEKIMETIISGMGG
LLGHITIIIVLGAMLGAIIEASGGAESLAQRFSKTLGLKRTVAALTMAAFILGIPVFFEV
GFIIVIPLIYGFTKVARVSPLKFGLPMAGVMLTVHVALPTHPGAAAAAAILHTDMGWLMM
LGILVSVPVGILGYYVAKVMNRRQYHLSVEVLEQLQMAKPEGAQKKNEPAPPGALTISGL
IVVPIVLIVLGTLSHSLLAQDSLPGKIMTVIGTPPIALLIALGLAAWLLGIRRGWSKDKL
EDLTGRAIPGSASVILVAGAGGAFGKVLVESGVGKALALALETLHLPLIPAAFILSLALR
ASQGSATVAILTTSGLLTQAVTGIDDMHRVLVTLAVCFGGLGLSHVNDAGFWVVTRYLGL
SVADGLKTWTVLTTLMGMTGFVLTWALWFVI
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgacgactgcgttgctgttagccattgcgaccgccagcattgtgattttgctgttgctg
gtcattaaagccaaagtccatccctttgtcgccctgttgattgtcagcctgctggtggcg
atcgccaccggtattccggctgaaaaaatcatggaaaccatcatcagcggtatgggtgga
ctgctggggcacatcaccatcattatcgtgctgggagccatgctcggggcgattatcgaa
gcttcgggcggcgccgagtcgctggcccagcgcttcagcaaaacgctgggcctgaaacgc
actgttgctgcactgaccatggccgcctttattctgggcatcccggtgttttttgaagtg
ggttttatcattgttatcccgctgatctacggctttaccaaagtggcgcgggtttctccc
ctgaagtttggcctgccaatggccggtgtgatgttaacggtacacgtggcgctgcccacc
catccgggtgccgcggccgctgcggccattttgcacaccgatatgggctggctgatgatg
ttggggattctggtctcggtgccggtcggcattttaggttattacgtcgcaaaggtgatg
aaccgtcgccagtatcatctgtcggtcgaggtgctggagcagctgcagatggcgaagccg
gaaggcgcgcagaagaaaaatgaacctgcaccgccgggtgcgctgaccataagcggtttg
attgtggtgccgattgtgctgattgtattaggtacgctgtctcactcgctgctggcgcag
gacagcctgccaggtaaaatcatgacggtgattggcacaccgcccatagcgctgctgatt
gcgttgggcctggccgcctggctactgggcatccgccgtggctggagcaaagataagctg
gaagatctgaccggccgggccattccgggatcggcgagcgtgattctggtggcgggcgcg
ggtggggcctttgggaaggtgctggtggagtccggcgtcggtaaagcgctggcgctggcg
ctggaaacgctgcacctgccgttaatccccgcggcctttattctgtcgctggcgctgcgc
gcctcgcagggatcggctaccgtcgcgattcttaccaccagcggcctactgacgcaggcc
gtgaccggcattgatgatatgcaccgtgttctggtcacgctggcagtgtgcttcggcggg
ctagggctgtctcatgtcaacgatgcgggcttctgggtggtgacgcgctatctgggcctg
tcggtagcggatggattaaaaacctggacggtactgacaaccctgatggggatgaccggt
tttgttctgacgtgggcgctgtggtttgtgatttga

DBGET integrated database retrieval system