KEGG   Pantoea ananatis AJ13355: PAJ_1753
Entry
PAJ_1753          CDS       T01969                                 

Gene name
ygbM
Definition
(GenBank) hydroxypyruvate isomerase YgbM
  KO
K22131  2-dehydrotetronate isomerase [EC:5.3.1.35]
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PAJ_1753 (ygbM)
Enzymes [BR:paj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.35  2-dehydrotetronate isomerase
     PAJ_1753 (ygbM)
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: BAK11833
UniProt: A0A0H3KXM9
Position
complement(2119717..2120502)
AA seq 261 aa
MPTFAANLSTQFNEVPFLQRFAAAAQAGFDAVEFLFPYDYPAEQLKTLLDDNGLKLVLFN
TAPGNVAAGEWGVSAIPGREAEARADIDRALDYALALDCPQVHIMAATVPSGADRQQYVE
TFIGNMRYAAERFAPHNIRLLIEALNPTTKPHYLYASQYQTLEMVELIDRPNVFTQLDLF
HAQMVDGNLSHLIRHYAGRYQHVQIAAAPSRHEPDEGEINYPWLFSLLDEVGYEGWIGCE
YFPRGDTVEGLSWLAPWAKHR
NT seq 786 nt   +upstreamnt  +downstreamnt
atgccaacgtttgcagctaacttatctacccagttcaatgaggtgccctttctgcagcgc
tttgccgccgctgcacaggcgggctttgacgcggttgaatttctgtttccttacgactat
ccggctgagcaactgaaaacgctgctcgatgacaacgggcttaaactggtgctgttcaat
accgcaccgggcaacgtggctgcgggggaatggggggtttcagccattcccggccgggaa
gcggaggcaagagccgatatcgacagggctctggactacgcgctggcgctggattgccca
caggtgcacatcatggcggcaaccgtcccttccggtgccgatcgccagcagtatgttgag
acgttcatcggtaatatgcgttatgcagcagaacgcttcgccccacacaacatccggttg
ttaatcgaagcgttaaatcccaccactaaaccccattatctctatgccagccagtatcag
acgctggagatggttgagctcatcgatcgtcccaacgtctttacccaactggatctgttc
catgcccagatggtggacggcaatctcagccacctcattcgccactacgccgggcgttat
cagcatgtgcaaatcgccgccgcgcccagtcgtcatgaacctgacgagggcgagatcaac
tatccctggctgttcagcctgcttgatgaggtgggttacgagggctggatcggctgcgaa
tatttcccgcgcggggacaccgtggaagggctgagctggctggcgccctgggcgaaacac
cgctga

DBGET integrated database retrieval system