KEGG   Pantoea ananatis AJ13355: PAJ_1754
Entry
PAJ_1754          CDS       T01969                                 

Gene name
ygbL
Definition
(GenBank) L-fuculose phosphate aldolase YgbL
  KO
K22130  3-dehydro-4-phosphotetronate decarboxylase [EC:4.1.1.104]
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PAJ_1754 (ygbL)
Enzymes [BR:paj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.104  3-dehydro-4-phosphotetronate decarboxylase
     PAJ_1754 (ygbL)
SSDB
Motif
Pfam: Aldolase_II
Other DBs
NCBI-ProteinID: BAK11834
UniProt: A0A0H3KXC3
Position
complement(2120502..2121167)
AA seq 221 aa
MNSFSAAHKRSFPMTEQQAREEMVRLGASFFQRGYATGSAGNLSLLLDDGTLLATPTGSC
LGELDAQRLSKVTLQGEWIAGDKPSKEIAFHRALYLNNPDCRAVVHLHSHYLTALSCLQN
LDSQNCIRPFTPYVVMRVGDVPVVPYYKPGDARLAEDLALLAPRYRAFLLANHGPVVVGK
SLQEAADNTEELEETARLMFTLGDRAIRYLTADEVAELRSR
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaacagtttttccgccgcgcacaaacggagttttcccatgactgaacaacaggcccgt
gaagagatggtcaggctgggcgcatctttcttccagcgcggttatgccacaggatcggcc
ggtaatctttcgctgctgctggacgatggcaccctgctggcgacgcccaccggctcctgc
ctgggcgaactggatgcccagcgcctgtctaaagtgacgttacagggggagtggatagcc
ggggataaaccctcaaaagagatcgcctttcaccgggcgctctacctgaataaccccgac
tgccgggcagtggttcatctgcacagccactatctgaccgcgctctcatgcctgcaaaat
ctggacagccagaactgcatccgcccgtttacgccctacgtggtaatgcgggtgggcgat
gtgccggtggtgccctactataaacccggcgacgcgcgactggcggaagatctggctctt
ctggcgccgcgctaccgtgctttcctgctggcgaaccatggtccggtggtggtgggcaaa
tccctgcaggaagccgcggacaataccgaagagttggaagaaaccgcacgcctgatgttt
accctgggcgaccgggccattcgctatcttaccgccgacgaagtcgccgaactcaggagc
cgataa

DBGET integrated database retrieval system