KEGG   Pantoea ananatis AJ13355: PAJ_1756
Entry
PAJ_1756          CDS       T01969                                 

Gene name
ygbJ
Definition
(GenBank) 3-hydroxyisobutyrate dehydrogenase YgbJ
  KO
K08319  L-threonate 2-dehydrogenase [EC:1.1.1.411]
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PAJ_1756 (ygbJ)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.411  L-threonate 2-dehydrogenase
     PAJ_1756 (ygbJ)
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_11 3HCDH_N F420_oxidored AlaDh_PNT_C 2-Hacid_dh_C UDPG_MGDP_dh_N TrkA_N ADH_zinc_N
Other DBs
NCBI-ProteinID: BAK11836
UniProt: A0A0H3KXQ8
Position
complement(2122383..2123288)
AA seq 301 aa
MPVSHICVIGLGSMGMGAAQSCIRAGLSTWGVDLNPQALDALRQAGARDAQTSAHAFASQ
LDAVLLLVVNAKQVNTILFGEQGLAARLKPGTAVMVSSTLSAQDAQQIAAKLADYHLLML
DAPVSGGAAKAASGEMTVMASGSDEAFAALQPVLDAVAAKVYRVGTEIGQGSTVKIIHQL
LAGVHIAVGAEAMALAARAGIPLETMYEVVTNAAGNSWMFENRMRHVVDGDYRPTSAVDI
FVKDLNLVAETAKALHFPLPLASTALNMFTEASNAGYGREDDSAVIKIFSGITLPQREGE
I
NT seq 906 nt   +upstreamnt  +downstreamnt
atgccagtttcacatatttgtgtcataggcttaggctcaatgggaatgggcgccgcgcag
tcctgcattcgtgccgggctgtcaacctggggcgtggatctgaatccgcaggcgctggat
gcgctgcgtcaggcgggcgcgcgcgatgctcagacgtcggcgcatgcctttgccagccag
cttgatgctgtgctgctgctcgtggtgaatgccaaacaggttaacacgatcctgtttggc
gagcaggggctggccgccaggctgaagccaggcacggcggtaatggtttcttccaccttg
tccgcgcaggatgcacagcagatcgccgcaaaactggcggactatcacctcctgatgctg
gatgcaccggtatccggcggggcggccaaagccgccagcggcgagatgaccgtgatggcg
tccggcagcgacgaggcgtttgctgccctgcaaccggtactggatgcggtggccgcgaag
gtttatcgcgtcggcacggaaatcggtcagggatcgacggtcaagattattcatcagctg
ctggctggcgtgcacattgccgtcggggccgaagccatggcgctggccgcccgcgccggg
atcccgctggagacgatgtatgaggtggtgaccaatgcggccggcaactcgtggatgttc
gaaaaccgtatgcgccatgtcgtcgatggcgactaccgaccgacatccgcggtagatatc
tttgtcaaagatctcaacctggtcgccgagacggcgaaagccctgcatttcccgctgccg
ctggcctccaccgcactgaatatgttcaccgaggccagcaatgccggttatggccgtgag
gatgacagtgcggtcattaaaatcttcagcggcattacgctgcctcaacgcgagggggaa
atctga

DBGET integrated database retrieval system