KEGG   Pantoea ananatis AJ13355: PAJ_1757
Entry
PAJ_1757          CDS       T01969                                 

Gene name
ygbI
Definition
(GenBank) putative HTH-type transcriptional regulator YgbI
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: DeoRC HTH_DeoR HTH_11 HTH_24 GntR MarR_2 HTH_23 MarR Rrf2 HTH_20 HTH_PafC TrmB HTH_Mga Sigma70_r4 HTH_5 PaaX HTH_IclR HTH_AsnC-type Fe_dep_repress HTH_28 DDRGK DUF977 HTH_psq HTH_Tnp_ISL3 HTH_38 Mga HTH_7
Other DBs
NCBI-ProteinID: BAK11837
UniProt: A0A0H3L4S3
Position
2123553..2124323
AA seq 256 aa
MIPVERHQQILALVAERGVMSINELTERFGVSHMTIRRDVQKLEEQGAVLSVSGGVRSAN
RLASEPSHLTKTALFNEEKKAIGKLAAQLIPPDSCIYLDAGTTTLALAREIADREDLLVV
TNDFMVTNLLMEASRCRVIHTGGTVCRDNRSCIGDAAARHLRQLAIDIAFVSTSSWGLRG
LFTPDEDKVAVKQAVCEVSSKRILLSDSSKYDKIATWLALPLEKFDVIVTDDQLNAAGRN
ALQAGSWELMMAGKSE
NT seq 771 nt   +upstreamnt  +downstreamnt
atgattccggttgagcgtcatcaacagattctggctctggtggcagagcgcggcgtaatg
agcattaacgagcttacggagcgttttggcgtgtcacatatgactattcgccgggatgtg
caaaagctggaagaacagggcgcggtactctcggtgtcgggcggtgttcgttccgctaac
aggctggcgagcgagccctcacatctgaccaaaacggccctgttcaatgaagaaaaaaaa
gccattggcaagttagccgctcagcttattccgccagacagctgcatctatctggatgcc
ggcaccaccacgctggcgctggcgcgggaaattgccgaccgggaggatctgctggtcgtc
actaatgattttatggtgaccaatctgctgatggaggcgagtcgctgtcgggtgattcac
accggcggtacggtgtgccgggataaccgctcctgcattggcgatgcggcggcacgtcac
ctgcgtcaacttgcgatagatatcgcctttgtgtccacctcaagctgggggctgcgcgga
ttgtttacaccggatgaagacaaggtggcggttaaacaggccgtgtgcgaggtcagcagc
aaacgcatcctgctcagcgacagctctaagtacgataaaatcgcgacgtggctggcctta
ccgttggagaagtttgatgtgatcgtgacggatgatcaattgaatgccgcaggacgaaat
gcgttacaggcaggaagttgggaactgatgatggccggaaaaagcgaataa

DBGET integrated database retrieval system