KEGG   Pantoea ananatis AJ13355: PAJ_1758
Entry
PAJ_1758          CDS       T01969                                 

Gene name
yeeF
Definition
(GenBank) inner membrane transport protein YeeF
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-ProteinID: BAK11838
UniProt: A0A0H3KXN3
Position
complement(2124374..2125732)
AA seq 452 aa
MSLNTSAAPQRAQLKKTLTLLPVVMMGLAYMQPMTLFDTFGIVSGLTDGHVATAYAFALI
AILFTAVSYGKLVRRFPSAGSAYTYAQKAISPHVGFMVGWSSLLDYLFMPMINILLAKNY
FETLVPGIPSWIFVVLLVGFMTLSNLKGIKTVANFNSVIVILQVVVMVGITAMVIYGVAH
GEGAGTVVSSKPFWSENAHVVPMITGATILCFSFLGFDGISSLSEETKDAERTIPRAIFL
TALIGGLMFIVASYFLQLYFPDISRFKEPDSSQPEIMLYVAGKALQVGILIFSVVTVLAS
GMAAHAGVSRLMYVMGRDGVFPERFFGYIHPKWRTPSLNVILVGAVALMAINFDLVTATA
LINFGALVAFTFVNLSVIAQYWIREKRNKTLKDHFQYLVLPMLGALTVGALWVNLEQSSM
VLGLIWAAIGILYLAFVTRSFRNPVPQFSEEV
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgtcgcttaatacctctgctgcaccacaacgtgctcaactgaaaaaaacgctgacttta
cttccggtcgtcatgatgggcttagcctacatgcagcctatgaccctgttcgataccttt
ggtattgtgtcgggcctgaccgatggtcacgttgccaccgcctatgctttcgccctgatt
gcgattctgttcactgccgtgagttacggtaagctggtacgccgcttcccatctgcgggc
tccgcttatacctacgctcaaaaggcaatcagtccgcacgtcggttttatggtgggctgg
tcatcgctgctggactacctgttcatgccgatgatcaacatcctgctggcaaaaaactat
tttgaaaccctggtgccaggtatcccctcgtggattttcgtggtgctgctggtgggcttt
atgacgctctccaaccttaagggaatcaaaaccgtcgccaacttcaacagcgtgatcgtg
atcctgcaggttgtggtgatggtcggtattactgccatggtgatctacggtgtggcgcac
ggtgaaggtgcaggaacagtggtaagcagcaaaccgttctggtcggaaaacgcccacgtg
gtgccgatgattacgggagcgaccatcctgtgtttctctttcctgggttttgacggcatc
agttcgctgtcggaagaaacgaaagatgcagaacgtaccattccgcgtgcgattttcctg
accgcgctgattggtggcctgatgtttatcgtggcctcgtacttcctgcagctgtacttc
ccggacatctcgcgctttaaagagccggattcctcacagccggagatcatgctctacgtc
gcgggcaaagcgttgcaggtcggtatcctgatcttctccgtggtcaccgtactggcttcc
ggcatggcggcgcacgcgggcgtatcacgtctgatgtacgtaatgggccgtgatggcgta
ttcccggagcgtttcttcggctatatccatccgaaatggcgcacgccgtcactgaacgtg
attctggtcggtgccgtcgcgctgatggccattaacttcgatctggttaccgcgactgcg
ctgattaactttggtgcgctggtggcgtttaccttcgttaacctgtcggtgattgcgcag
tactggatacgtgaaaaacgtaacaaaaccctgaaagatcacttccagtatctggttcta
ccgatgctgggcgcgctgaccgttggtgcgctgtgggttaacctggagcagagctcgatg
gttctgggcttgatctgggccgccattggtattctctacctggcctttgtgacccgcagt
ttccgcaatccggttccccagtttagcgaagaagtgtaa

DBGET integrated database retrieval system