KEGG   Pantoea ananatis AJ13355: PAJ_1759
Entry
PAJ_1759          CDS       T01969                                 

Gene name
puuA
Definition
(GenBank) gamma-glutamylputrescine synthetase PuuA
  KO
K09470  gamma-glutamylputrescine synthase [EC:6.3.1.11]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00330  Arginine and proline metabolism
paj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    PAJ_1759 (puuA)
Enzymes [BR:paj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.11  glutamate---putrescine ligase
     PAJ_1759 (puuA)
SSDB
Motif
Pfam: Gln-synt_C Gln-synt_N_2
Other DBs
NCBI-ProteinID: BAK11839
UniProt: A0A0H3KXC9
Position
complement(2126105..2127520)
AA seq 471 aa
MTNLVEVEDFTLHSEERRTSAFQQEVKNWLERHPETQYVDILLNDLNGVFRGKRIPVSAL
AKLEKGCYFPASVFAMDILGNTVEEAGLGQSLGEPDNLCLPVPGTLVPSAADPQHIAQLL
LTMCNQDGTPFDVEPRNVLNRLWQQLRNRGLFPVVAVELEFYLVDKKRDAEGFIQPPCAP
GSDDRNMQSQVYSLDNLDHFSEVLRDIDTLARLQGIPADGALAEASPGQFEINLHHTRDV
LSACDHAIQLKRLIRQVAENHGMTATFMAKPYEDYAGSGMHVHISMLDAADHNAFACDDG
SDSPLLKRTLAGMIDLMPASMALLAPNVNAFRRFVPEAYVPLQASWGHNNRTVALRIPCG
DIESRRIEYRVAGADANPYLVMSAILAGMLHGLDTQLPLPQPVKGNGHEAEGLALPIRQS
DALTEFESSYPLQKLLGEKFAKVWFSCKNYELMQFERLITATEIDWMLKNA
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgactaacctggtagaagtagaagacttcacgttgcacagtgaagagagacgaaccagc
gcgttccagcaagaggttaaaaactggctggagcgccaccctgaaacccagtacgttgat
attttacttaatgatttaaatggtgtttttcgcggtaagcgcattcccgtctccgcgctg
gctaagctggaaaagggctgctactttcccgcctcggtctttgccatggatattcttggc
aacaccgttgaagaggccggactgggacaatccctcggtgagcccgataatctttgcctt
cccgttcccggcacgctcgttccctccgccgccgatccgcaacacattgcacaactgctg
ctaaccatgtgcaaccaagatggcactccctttgacgttgaaccccgaaatgtcctgaac
cggctgtggcaacagctgcgtaaccgtggactgtttccggtggtagcggtagagctggag
ttctatctggtcgataaaaagcgcgacgcggaaggttttattcagccgccctgcgcaccg
ggcagcgacgatcgcaatatgcagagccaggtctattccctggacaatcttgatcacttc
tcagaagtcttacgggatatcgataccctggcccgcctgcagggcattcctgccgacggc
gcgctggcggaagcgtcaccggggcagtttgaaattaacctgcatcacactcgggatgtc
ctgagcgcctgcgatcatgccattcagcttaagcgccttatccggcaggtggctgagaat
cacggtatgaccgccacctttatggcgaagccctatgaagactatgcgggcagtgggatg
cacgtacatatcagtatgctggacgcggccgatcacaacgcctttgcctgcgacgacggc
agcgactctccgctgctgaagcgcaccctggccggtatgatcgatttaatgcccgcctcc
atggcgttgctggcccctaacgtcaatgccttccgccgttttgtcccggaggcgtacgtg
ccgttgcaggcctcgtggggccataacaaccgcacggtggcgttgcgcattccctgtggg
gatattgaaagccgccgaatcgagtatcgagtggcgggagcggatgctaacccctatctg
gtgatgtccgcgattttagccggcatgttgcacggtctggatacgcaactgcctttgccg
cagccggttaaaggcaatggtcacgaggcggaagggttagcgttacccatccgtcaaagt
gatgcccttaccgagtttgaaagcagctatcctttacaaaaattactgggtgagaaattt
gccaaagtgtggtttagctgtaaaaattatgagctaatgcagtttgaaaggttaatcact
gccacagaaatcgactggatgttaaagaatgcctga

DBGET integrated database retrieval system