KEGG   Pantoea ananatis AJ13355: PAJ_1760
Entry
PAJ_1760          CDS       T01969                                 

Gene name
puuD
Definition
(GenBank) gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD
  KO
K09473  gamma-glutamyl-gamma-aminobutyrate hydrolase [EC:3.5.1.94]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00330  Arginine and proline metabolism
paj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    PAJ_1760 (puuD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:paj01002]
    PAJ_1760 (puuD)
Enzymes [BR:paj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.94  gamma-glutamyl-gamma-aminobutyrate hydrolase
     PAJ_1760 (puuD)
Peptidases and inhibitors [BR:paj01002]
 Cysteine peptidases
  Family C26: gamma-glutamyl hydrolase family
   PAJ_1760 (puuD)
SSDB
Motif
Pfam: Peptidase_C26 GATase
Other DBs
NCBI-ProteinID: BAK11840
UniProt: A0A0H3L1V8
Position
2127733..2128494
AA seq 253 aa
MGIIFDKPLIGVVMCQTHHHGHPVQSVHNKYLDAVVTAGGVPLALPHQLMAAPHLSENAM
AALDGILLTGSPSNLEPWLYGEAGEEPDADAGRDRLAFNLITHAVGKQLPLFGICRGMQE
LVVANGGALYRHLNQHPQFQRHHDDDAAPLSQQYAPAHDVNIEPGGLLAALLGPAPLIVN
SVHHQGIRETGPQLRIEARAPDGLIEAVSLSRHPFALAVQWHPEWQLKPATPSFALFNGF
IQAARHYQREKQQ
NT seq 762 nt   +upstreamnt  +downstreamnt
atgggcattatttttgacaagccgttgatcggcgtagtgatgtgtcagacgcatcatcac
gggcatccggttcagtcggtgcacaataaatatcttgatgccgtcgttaccgccggtggc
gtgccgcttgcgctgcctcatcagcttatggctgcccctcatctatcagaaaacgctatg
gctgcgctggacggaattttactgaccggcagccccagcaaccttgaaccctggctgtat
ggtgaagcaggtgaagaacccgacgcggatgccggacgggaccggctggcttttaatctg
atcacacacgccgtgggtaagcaactcccgctctttggcatctgccgcggcatgcaggag
ctggtggtagccaacggcggcgcactttaccgtcatcttaatcagcatccacagtttcag
cgccatcacgacgatgacgctgccccgctgtcgcaacagtacgcacctgcccatgatgtg
aatattgaacccggagggctactggccgcgctgctcggcccggcgccgttaatcgtgaat
tccgttcatcatcaggggatacgcgaaaccgggccacagctgcgcattgaagcccgggcg
ccagatggcctgattgaggcggtcagcctcagccggcatccttttgcgttggcagtacag
tggcatcccgagtggcagttgaaacccgcaacgccgtcctttgcgctgtttaacggcttt
attcaggccgcgcgtcattatcaacgggaaaagcagcaatga

DBGET integrated database retrieval system