KEGG   Pantoea ananatis AJ13355: PAJ_1761
Entry
PAJ_1761          CDS       T01969                                 

Gene name
puuR
Definition
(GenBank) HTH-type transcriptional regulator PuuR
  KO
K14056  HTH-type transcriptional regulator, repressor for puuD
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:paj03000]
    PAJ_1761 (puuR)
Transcription factors [BR:paj03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    PAJ_1761 (puuR)
SSDB
Motif
Pfam: HTH_3 HTH_31 HTH_19 HTH_26 MqsA_antitoxin HTH_37 HTH_25 Death
Other DBs
NCBI-ProteinID: BAK11841
UniProt: A0A0H3KXR1
Position
2128491..2128952
AA seq 153 aa
MNDANQAPGRRLSQIRQAMGLSQRRVAELAGLTHSAISTIEQDKVSPAVSTLQKLLKVYG
LSLSEFFSEPHSQDAPNVVVRPEDLLEIGSRGVSLKLIDNGTPKRDPGHAAGDLSSRCQY
RGKTAPRGRRNRYAAGRSDRSGDKRPAIPPVCR
NT seq 462 nt   +upstreamnt  +downstreamnt
atgaatgatgcgaatcaggctcccggacgtcggctgtcgcaaattcgccaggcgatggga
ttatctcaacggcgcgtcgctgaactggctggcctgacgcacagtgccatcagcaccatt
gagcaggacaaggtcagcccggcggtcagcacgctacaaaaactgttgaaagtttatggt
ctgtcgctgtcggaatttttctccgaacctcacagccaggatgcgcccaacgtggttgtc
cggcccgaggatctgctggagatcggcagccggggcgtttcactgaagctgattgataac
ggcaccccaaagcgcgaccctgggcatgctgctggagacctatcttcccggtgccagtac
cggggaaaaactgcaccacgcgggcgaagaaaccggtacgctgctggaaggtcagatcgt
tctggagataaacggccagcaattccacctgtctgccggtga

DBGET integrated database retrieval system