KEGG   Pantoea ananatis AJ13355: PAJ_1762
Entry
PAJ_1762          CDS       T01969                                 

Gene name
puuB
Definition
(GenBank) gamma-glutamylputrescine oxidoreductase PuuB
  KO
K09471  gamma-glutamylputrescine oxidase [EC:1.4.3.-]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00330  Arginine and proline metabolism
paj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    PAJ_1762 (puuB)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.-  
     PAJ_1762 (puuB)
SSDB
Motif
Pfam: DAO FAD_binding_3 NAD_binding_8 Thi4 FAD_binding_2 Pyr_redox_2 ApbA Pyr_redox Pyr_redox_3 HI0933_like GIDA UDPG_MGDP_dh_N FAD_oxidored
Other DBs
NCBI-ProteinID: BAK11842
UniProt: A0A0H3L4S8
Position
2129077..2130354
AA seq 425 aa
MNYVENYYTATMNPHAPWPVLQESIQCDVCIIGAGFTGLSAGLFLTEAGYDVVLLEAARV
GFGASGRNGGQAVNSYSRDVDVIEQRYGKDTAKMLGSMMFEGGDIIRDRIDRYAIACDYR
PGGIFAAFNSRQMAHLAKQKAAWARYGNHELELLDERGIRREVATERYVGGLLDKRGAHL
HPLNLALGEAEAIRRHGGRIYEHSAALSVDYGAPNRVKTAQGEVRATFLIFAGNAYLPSE
LEPRLSRKSMPCGSQIIATEPLSRDRALALLPNNYSVEDCNYLLDYFRLTADNRLLYGGG
VVYGAREPGDVEKMIRPKMLRTFPQLHNVKIDFAWSGNFLLTLSRMPQFGRLENNVYFMQ
GDSGHGVTCTHLSGKLISEVLRGDAERFDAFAKLPHLPFPGGRRFKVPLTAMGAAWYALR
DRLGV
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgaattatgtggaaaattactacaccgcaacaatgaatccacatgcgccctggccagta
ttacaggaaagcattcagtgtgacgtctgcattatcggcgcgggctttactggcctgtca
gccggtttgtttttaaccgaggcgggctatgatgtggtactgcttgaagccgcacgggtc
ggttttggtgccagcggtcgcaacggcggacaggcagtgaactcctacagccgggatgtg
gatgtgattgaacagcgttatggcaaagacaccgcgaaaatgctgggcagcatgatgttt
gaaggcggggatattatccgcgatcgtatcgatcgttatgcgatcgcctgcgactaccgc
ccgggtggcatttttgccgcctttaattctcgtcagatggcgcatctggcgaaacaaaaa
gcggcctgggcgcgctatggcaatcatgagctggaactgctggacgaacggggcattcgg
cgggaagtcgcgacagaacgctatgtcggcggattactcgacaaacgtggtgcgcatctg
catccactgaatctggcgctgggcgaagccgaagcgattcgtcgtcacggcggacgcatt
tatgagcattctgctgcgttaagcgttgactatggtgcgccaaaccgggtgaaaacagca
caaggtgaagtgcgtgccacttttctgatcttcgcgggtaacgcctatttaccttcggag
ctggaaccacgcctgagccggaaaagcatgccgtgcggctcgcagattatcgcgaccgaa
ccgctgtcacgggatcgggcgcttgcgctgttacccaataactattcggtcgaggactgt
aactatctgctggattatttccgcctgaccgcagataaccgcctgctatacggcggcggc
gtcgtttacggcgcgcgggaacctggcgacgtggagaaaatgatccgtcccaagatgctg
cgcacctttccgcagttgcacaacgtaaaaattgatttcgcctggagcggcaattttttg
ctgacgctgtcgcgcatgccgcagtttggtcggctggaaaacaacgtttattttatgcag
ggcgacagcggtcacggcgtcacctgtactcacctttccggcaagcttatcagcgaagtg
ctgcgcggcgatgcggagcgcttcgacgcctttgcgaagcttccgcatctgcccttccct
ggcggacggcggtttaaagtgccactgacggcgatgggcgccgcatggtatgcgctgcgc
gacaggctcggcgtgtaa

DBGET integrated database retrieval system