KEGG   Pantoea ananatis AJ13355: PAJ_3025Help
Entry
PAJ_3025          CDS       T01969                                 

Gene name
mqo
Definition
(GenBank) malate:quinone oxidoreductase Mqo
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00020  Citrate cycle (TCA cycle)
paj00620  Pyruvate metabolism
paj01100  Metabolic pathways
paj01110  Biosynthesis of secondary metabolites
paj01120  Microbial metabolism in diverse environments
paj01200  Carbon metabolism
Module
paj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAJ_3025 (mqo)
   00620 Pyruvate metabolism
    PAJ_3025 (mqo)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     PAJ_3025 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo
Motif
Other DBs
NCBI-ProteinID: BAK13105
UniProt: A0A0H3L8A7
Position
3620570..3622183
Genome map
AA seq 537 aa AA seqDB search
MCKSAVNLALMMSVSGKDTTRAQERKDVDVLLIGAGVMSATLGTWLQDLEPDWSIEMVER
LGHVAEESSNGWNNAGTGHAALAELNYTPQRADGSIDIAKAVAINESFQISRQFWAYHVQ
KGNLHTPKSFIHSTPHMSFVWGDDNVAFLRKRFTALQKSTLFRGMAYSEDPQQIAQWIPL
VMKGRASNQKVAATWTDMGTDVDFGEVTRQLIASLEQKANFRLRMHQEVREITRLNDGRW
QVTLVCMKEGTRRTLTAGKIFIGAGGAALPLLQKAGIPEANGYAGFPVGGSFLVTENPDV
VKQHMAKVYGKASVGAPPMSVPHVDTRVLNGKQVLLFGPFATFSTKFLKQGSLLDMFASL
NSTNVMPMIKVGLKSFDLVKYLMDQVLQSDRDRMDALRAYVPQAKQEDWRLVTAGQRVQI
IKKDEKEGAVLRLGTEVVSSEDGSVSALLGASPGASTAAPIMLELLHKVYPEQMASPEWQ
NKIRAVVPSWGRKLNGDVALTEKVLAETSRILQLKYTPVTPVAANDEGRETAYVIGK
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaaatcagctgtaaatcttgcgctcatgatgagtgttagcggaaaggacaccacc
agggcgcaggagcgtaaagacgttgatgtactgcttattggcgcaggcgtcatgagtgct
acgttaggaacctggcttcaggatctggaacctgactggtccatcgaaatggtggagcgg
ctgggacacgtagcggaagagtcttcaaatggctggaacaacgcgggtacaggccatgcg
gcgctggccgagttgaactatacgcctcagcgagccgatggcagtatcgatatcgccaaa
gccgttgcgattaacgagtcattccaaatttctcgccagttctgggcttatcacgttcag
aaaggcaacctgcatacgccgaaaagctttattcacagcactccgcacatgagctttgtc
tggggcgatgataatgtcgcgttcctgcgcaagcgctttactgccttacagaaaagcacg
ctgttccgcggcatggcttactctgaagatccgcaacaaatcgcacagtggattccgctg
gtcatgaaaggccgtgcgtcgaatcagaaagtggcagcaacctggacagacatgggtacc
gacgtcgatttcggtgaagtaacgcgccagctgattgcttcactggagcaaaaagccaac
ttccgtttacggatgcatcaggaagtgcgcgagattacccgccttaatgatggccgctgg
caggtgacgctcgtctgcatgaaagagggtacacgccgcacgttgacggctggaaagatc
tttattggcgcgggcggtgcggcgctgccgctgctgcagaaggccggcattccggaagcc
aacggctatgcgggcttcccggttggcggttccttcctggtcaccgagaatccagacgtc
gtgaaacagcacatggcgaaagtctatggcaaagccagcgtgggcgcgccaccgatgtcc
gtgccccatgtcgatacgcgtgtgctgaacggcaagcaggtgctgctgtttggtcccttt
gcgaccttctcgaccaaattcctgaagcagggctcgctgctggatatgtttgcctcactc
aacagcaccaacgtaatgcccatgatcaaggtcggactgaaaagctttgatctggtgaaa
tacctgatggatcaggtgctgcaaagtgaccgcgatcgtatggatgcactgcgtgcttat
gtgccacaggcgaaacaggaagactggcgcctggtgacggccgggcagcgcgtgcaaatc
atcaagaaagatgagaaagaaggcgcagtgctgcgtttaggcacggaagtggtgtcgtcc
gaagacggctctgtctcagcgctgctgggtgcctcgccaggtgcctcgaccgccgcgccg
attatgctggagctgctgcataaggtctatccggagcagatggcgtcgccggagtggcaa
aataaaatccgtgccgtggtgccgtcctggggccgtaagctgaatggcgatgtggcgctg
actgaaaaagtactggcagaaaccagccgtatcctgcagctcaaatacacgccggttacg
ccagtggctgccaacgatgaaggccgtgaaaccgcctatgtcataggcaaataa

DBGET integrated database retrieval system