KEGG   Pantoea ananatis AJ13355: PAJ_3065Help
Entry
PAJ_3065          CDS       T01969                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase MetF
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00670  One carbon pool by folate
paj01100  Metabolic pathways
paj01120  Microbial metabolism in diverse environments
paj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PAJ_3065 (metF)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     PAJ_3065 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: BAK13145
UniProt: A0A0H3L8E7
Position
complement(3675184..3676191)
Genome map
AA seq 335 aa AA seqDB search
MIYQLTLAGKWFTLSVWTSKRIDVCRLTDNRCGGGSRMSFFHANQREALNQSLAELNGRI
SVSFEFFPPRTSEMEETLWNSIHRLSSLKPSFVSVTYGANSGERDRTHSIIKGIKERTGL
EAAPHLTCIDATRDELQAIAQDYWNNGIRHIVALRGDLPPNSGKPEMYGSDLVSLLKEVG
DFDISVAAYPEVHPEAKSAQADLINLKRKIDAGANRAITQFFFDVESYLRFRDRCVSTGI
DVEIVPGILPVSNFKQLQRFAALTNVRVPGWMNAMFAGLDGDPETRKMVGANIAMDMVKI
LSREGVKDFHFYTLNRAEMSYAICHTLGVRPGIAA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgatttatcagttgacgcttgcgggaaaatggttcactttgagtgtctggacgtctaaa
cgtatagatgtttgcaggttaacagataaccgatgtggcggaggtagcaggatgagtttc
tttcatgccaatcagcgcgaggcgctcaatcagagcctggcagagctaaacgggcgaatt
agtgtctcttttgagtttttcccgccgcgcaccagtgaaatggaagaaacgctgtggaac
tccatccatcgtctgagcagcctgaagcccagttttgtctctgtaacctacggggcgaac
tcgggtgagcgtgaccgcacacacagcatcattaaaggcattaaagaacgtacggggctc
gaagctgcgccgcatctgacctgtattgacgctacccgggatgagctgcaagccattgca
caggattactggaataacggtattcgccatatcgtggcgctgcgtggcgatctgccaccc
aatagcggtaagccggaaatgtacggcagcgatctcgtttcgctgcttaaagaggtcggt
gacttcgatatctccgtcgcggcctatccggaagtccaccccgaagcaaaaagtgcccag
gctgacctgattaacctgaaacgtaaaattgatgctggcgctaaccgtgccattacccag
ttcttctttgatgttgaaagctatctgcgttttcgtgatcgctgcgtttccaccggcatt
gatgttgagatcgtgccgggcattttgccggtatcgaatttcaaacagctgcagcgtttt
gccgccctgaccaatgtacgcgttccgggctggatgaatgccatgtttgcagggctggat
ggggatcctgaaacgcgcaaaatggtgggggcgaacatcgccatggacatggtgaaaatc
ctgtcgcgtgagggcgtaaaggatttccatttctatactctgaaccgggcagaaatgagc
tatgccatttgtcataccttaggtgtgcgtccgggaattgccgcctga

DBGET integrated database retrieval system