KEGG   Propionibacterium acnes SK137: HMPREF0675_3577Help
Entry
HMPREF0675_3577   CDS       T01215                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pak  Propionibacterium acnes SK137
Pathway
pak00900  Terpenoid backbone biosynthesis
pak01100  Metabolic pathways
pak01110  Biosynthesis of secondary metabolites
pak01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF0675_3577 (ispE)
Enzymes [BR:pak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HMPREF0675_3577 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADD99185
UniProt: D4HC42
Position
599091..600062
Genome map
AA seq 323 aa AA seqDB search
MVMMDDPFDLLRPMTVTVRVSAKVNLALGVGGLAPDGFHPLATVFEAICIYDEVAVTRRD
DSRITLTVSGEDADQVPTDETNLAWRAVELVREEFASEWGKRGHGADIHIDKSIPVAGGM
AGGSADAAGALMAAAALCRLPYSPEELQPLAAQLGSDVPFCLTGGVALGRGRGDRLAPVI
CRGRHRWVFATSNQGLSTPAVYRRFDELGGTPGGETVPNDLISALTRGDLDAVAASLSND
LQAAAIDLRPELEEVLTVGREVGALTALVSGSGPTCAFLVRDTAGAKKVSAAVSNLPQVH
RTRTARGPAAGAQLLPGPVGSFA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgatggacgatccgtttgacttgctccggccgatgaccgtgacggtgcgggtc
agcgccaaggtcaatctggcgctcggggttggtggccttgcgcccgacggctttcacccg
ttggcgactgtcttcgaagctatctgcatttacgatgaggtggcggtgactcgtcgcgac
gattcgcgcatcaccctcaccgtctcaggagaggacgccgatcaggtccctaccgacgag
acgaatttggcctggcgagctgtagaactcgttcgcgaggaattcgcttcagaatggggg
aaacgtggccatggcgccgacattcacatcgataaatcgatcccggtcgctggtgggatg
gctggaggatcagctgacgcagcgggcgccctcatggcagcggccgcgctgtgtcggctc
ccttactcccccgaggaattacaaccgttggctgctcagcttggctccgacgtgcccttc
tgtctcaccggtggagtggcgttagggcgaggtcgaggagaccgtcttgcgccagtgatc
tgccgaggacgtcatcgctgggtgttcgcgacatcgaatcagggactgtccaccccggct
gtctaccgacgtttcgacgagttgggcggcacccctgggggagaaacggtgcccaatgac
ctcatctcggccttgacccgcggcgatcttgatgctgtcgctgccagtttgagcaatgac
ttacaggccgctgccatcgaccttcggcccgaactcgaagaggtgttgacggttgggcga
gaggtgggtgcgttgaccgctttggtttctggatcggggccgacctgcgccttcctcgtc
cgggacaccgctggcgccaaaaaggtgagcgctgctgtgtccaatctgcctcaggttcat
cgcacccgaactgcccgcggtccagctgcgggagcgcagctcctgcctggcccggtgggg
agctttgcatga

DBGET integrated database retrieval system