KEGG   Cutibacterium acnes SK137: HMPREF0675_4725Help
Entry
HMPREF0675_4725   CDS       T01215                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
pak  Cutibacterium acnes SK137
Pathway
pak00471  D-Glutamine and D-glutamate metabolism
pak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pak00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    HMPREF0675_4725 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pak01011]
    HMPREF0675_4725 (murI)
Enzymes [BR:pak01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     HMPREF0675_4725 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:pak01011]
 Precursor biosynthesis
  Racemase
   HMPREF0675_4725 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ADE00931
UniProt: D4H980
Position
complement(1782503..1783357)
Genome map
AA seq 284 aa AA seqDB search
MTEPDFDVVDSPIGIFDSGFGGLTVARSVVDLMPNEDIVYLGDTDRAPYGEKTIADVRQY
ALQCLDRLVAHGVKALLIACNTASSAVLRDARERYGVPVIDVIMPAARRASAATRNGRIG
VICTEATARSLSYEDALAAVPGITLTTQACPKFVPFVEDGITSGPELETIAREYLAPIQE
AGCDTLILGCTHYPLLAGLISYVLGDGVTLISSSQQCARASYSLMAESGLLHSHPRDSSR
YFLTTGNAERFEKLGRRLMEGFVHDVQSVHADAHSLGDRAVVRD
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaacctgatttcgacgttgtcgactcaccgatcggcatcttcgactccggattc
ggagggctgacggtggctcgatcggtcgtcgaccttatgccgaacgaagacatcgtttat
ctgggcgacacggaccgcgctccctacggtgagaaaaccatcgctgacgtacgacaatat
gcgttgcaatgcctcgaccgacttgtcgcccacggcgtcaaagccctgcttatcgcctgt
aataccgcatcctcggcggtgttaagagatgcccgggagcgttacggtgtgccggttatt
gatgtcatcatgccggctgctcgtcgggccagtgctgctacccgtaacgggcgaattggc
gttatttgtactgaggcgacagctcgctctctgtcctatgaggatgcattggctgcggtg
cccggcatcactctgacgactcaggcctgcccgaaattcgtcccgttcgttgaggacggg
atcaccagcggaccggagcttgagactattgcccgggagtatctggcgcctatccaggag
gctggttgtgacactctcatcttggggtgcactcactatccgctgctggctgggctcatc
tcgtatgtcttgggtgacggcgtcaccctcatttcttcctcccagcagtgtgcccgcgcg
tcttattctttgatggctgaatctgggctgttgcattcccatcctcgcgattcgagccgc
tatttccttactacggggaatgctgagcgtttcgagaaactgggacgacggctgatggag
ggattcgtccacgatgtgcagtcggtgcatgctgatgcgcactccctcggtgatcgcgcg
gttgtccgagactga

DBGET integrated database retrieval system