KEGG   Propionibacterium acnes SK137: HMPREF0675_5343Help
Entry
HMPREF0675_5343   CDS       T01215                                 

Gene name
ald
Definition
(GenBank) alanine dehydrogenase
  KO
K00259  alanine dehydrogenase [EC:1.4.1.1]
Organism
pak  Propionibacterium acnes SK137
Pathway
pak00250  Alanine, aspartate and glutamate metabolism
pak00430  Taurine and hypotaurine metabolism
pak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF0675_5343 (ald)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    HMPREF0675_5343 (ald)
Enzymes [BR:pak01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.1  alanine dehydrogenase
     HMPREF0675_5343 (ald)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AlaDh_PNT_C AlaDh_PNT_N 2-Hacid_dh_C NAD_binding_8 GIDA Pyr_redox_2 HI0933_like Pyr_redox UDPG_MGDP_dh_N 3HCDH_N FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ADD99877
UniProt: D4HBJ2
Position
complement(2390908..2392029)
Genome map
AA seq 373 aa AA seqDB search
MCVMRVGVPTEVKNSEFRVAVTPAGVHALVGRGHEVLVQAGAGVGSGIPNSDFVGAGARV
VGDVESVWGDADLVLKVKEPVAEEYGRLHEGLVLFTYLHLAADEALTRELLGRGVTSIAY
ETVELADHSLPLLSPMSEIAGRLAAQVGANCLLQSAGGRGVLFGGGSGVRRGRVSVLGGG
VAGLCAARVAAGMGADVTVFDVDVARMRYIDEVWGGRIGTRFSSPLAVREACGESDVVIG
SVLVPGARTPHLVDHEMVLGMVPGSVLVDVAVDQGGCFEDSHPTTHADPTFVVGGSVFYC
VANMPGAVPHTSTYALTNATMRYVLLLADEGWRGACGSRDDLRRGLATCGGKLVSAPVGE
ALGIECVPVSEVL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtgtgatgcgtgttggtgttcctactgaggttaagaatagtgagtttcgtgtggct
gtgacgccggcgggtgttcatgcgttggttggtcgtggtcatgaggtgttggttcaggct
ggtgctggtgtgggttcgggtattccgaattcggattttgtgggtgctggtgcgcgggtt
gtgggtgatgtggagtcggtgtggggtgatgctgatttggtgttgaaggtgaaggagcct
gttgcggaggagtatgggcggttgcatgagggtttggttctttttacgtatcttcatttg
gctgctgatgaggcgttgactcgtgagcttttggggcgtggggtgacgtcgattgcgtat
gagacggtggagttggctgatcattcgttgccgttgttgtctccgatgtcggagattgcg
ggtcggttggctgctcaggtgggtgcgaattgtttgttgcagtctgctgggggtcgtggt
gtgttgtttggtggtggttcgggtgtgcgtcgtggtcgggtgagtgtgcttggtggtggt
gtggctgggttgtgtgcggctcgtgtggctgcgggtatgggtgctgatgtgacggtgttt
gatgtggatgtggcgcggatgcgttatatcgatgaggtgtggggtgggcgtattggtacg
cggttttcgagtccgttggcggttcgggaggcgtgtggtgagtctgatgtggtgattggg
tcggtgttggtgcctggtgctcggactccgcatttggtggatcatgagatggtgttgggg
atggtgccggggtcggtgttggtggatgttgcggtggatcagggtgggtgttttgaggat
tctcatccgacgacgcatgcggatccgacgtttgtggtggggggttcggtgttttattgt
gtggcgaatatgccgggtgcggtgccgcatacgtcgacgtatgcgttgacgaatgcgacg
atgcggtatgtgttgttgttggctgatgagggttggaggggtgcgtgtgggtcgcgtgat
gatttgcggcgtggtttggcgacttgtggtgggaagttggtgagtgcgccggtgggtgag
gcgttgggtattgagtgtgtgcctgtgtctgaggtgttgtga

DBGET integrated database retrieval system