KEGG   Cutibacterium acnes SK137: HMPREF0675_5357
Entry
HMPREF0675_5357   CDS       T01215                                 

Definition
(GenBank) B12 binding domain protein
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
pak  Cutibacterium acnes SK137
Pathway
pak00472  D-Arginine and D-ornithine metabolism
pak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pak00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    HMPREF0675_5357
Enzymes [BR:pak01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     HMPREF0675_5357
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: ADE01224
UniProt: D4HBK6
Position
2406859..2409099
AA seq 746 aa
MTPSEPVEPRTEQDLPGPNTKLNVEEILTDLEHYHPRRKGWTWRNVPEEGIDMGDFHYRN
MSTPLKQSMPLPAAEYFENIDPQPAPVVTSEIASGHFEDDLRRMRMAAWHGADHIMVIRT
TGQSHIDGLLEGTPEGIGGVPITRKQLRASRKACDLIEDEVGRPINFHSYVSGVAGPEVA
VLFAEEGVNGAHQDPQYNLLYRNINAYRSYVDAGEAKKAMAGAQIFQIDGAHNANATARH
GWKVMPELMVQHGLNCMYSVLVGMPKDLIGLSTVPPSAPPAPKLWYDLPYAVALRDLFSE
YKMRAQQNTRYIESDLAEAIRTHTIDTLIAMLTSADIQSTITPDEGRNLPWHHNSVRGVQ
TVKQTWAALDGIKEMVTINREGPLGHMVRDLKERAIGFLTEMLHVGGYFVAVEDGFFVDS
AEFPERNHDGIARDGQGGIAEGTVVERDPDYLAPVCDHFGNNNLPEGLNKPCDLIDGCTL
CKPEKIVYIDELDPNDSAATRLACTRPFRDGTALRPEAEWAGDGVVLVQMNIPGSEDIAR
EAAVEMARKMGITDPQVCNLQVLHPAEGCFVEVKGQATHVDVNPSKLTIPEKIELLPADE
LRQFVTDHELSVVAGTVGEDEHSVGLREILDIKHGGIEKYGVKYRYLGTSVPVEKMVDAA
IESGADAILISTIISHNDIHRTMMRKLADLATEKGIRDKVVLVAGGTQVNREMAAETGLD
ATFGRGTKGIDVLDAIVRTMRTRAEA
NT seq 2241 nt   +upstreamnt  +downstreamnt
gtgacgccttcagagcccgtcgagccccgcaccgagcaggacctcccaggcccgaatacc
aaactcaatgtcgaggagatcctcaccgaccttgagcactaccacccccgtcgcaaggga
tggacctggcggaacgtgccggaagagggaatcgacatgggcgacttccactaccggaac
atgtccaccccgttgaagcagagcatgcctctgcccgccgcagagtacttcgagaacatt
gatccccagccggcacccgtcgtcacctccgagatcgcctccgggcacttcgaggacgac
ctgcgccgtatgaggatggcggcctggcacggagctgaccacatcatggtcatccgcacc
accggacagagccacatcgacggactactagagggcaccccggaaggtatcggcggcgtt
ccgatcacccgtaaacagctgcgcgctagccgcaaggcctgcgacctcatcgaggacgag
gtagggcgccccatcaacttccactcctacgtgtccggagtcgccggccctgaggtggcc
gtcctcttcgccgaagagggggttaacggtgctcatcaagacccgcaatacaacctgctg
taccgcaacatcaacgcctaccgcagctatgttgacgccggtgaagccaagaaggcgatg
gcgggagctcagatcttccaaatcgacggtgcacacaacgccaacgccactgcccggcac
ggttggaaggtcatgcccgagctcatggtccagcacggcctcaactgcatgtactcagtg
ctggtaggaatgccgaaggacctcatcggcctgtcgacggttccgcccagcgctcccccg
gcgccgaaactctggtacgacctgccgtacgcagtagccctgcgcgatctgttcagcgag
tacaaaatgcgcgcccagcagaacacccggtacatcgagtccgacctcgccgaggccatc
cgcacccacaccatcgacactctcatcgcaatgctgaccagcgcggacatccagagcacc
atcacccctgatgaaggccgcaacctgccctggcaccacaactctgtccgcggcgtccag
acggtcaaacagacctgggccgctctcgatggcatcaaggagatggtgaccatcaaccgc
gaggggccactcggccacatggtgcgtgacctcaaggagcgggcgatcggtttcctcacc
gagatgctgcacgtgggtggctacttcgtcgccgttgaggacggattcttcgtcgactcg
gcagaattcccggaacgcaaccacgacggcatcgcccgtgacggccaaggcggaatcgcc
gagggaaccgtcgtcgagcgtgaccccgactacctcgccccagtctgcgaccatttcggc
aacaacaacctgcccgagggccttaacaagccgtgcgacctcatcgacggctgcaccttg
tgcaaacccgagaaaatcgtctacatcgatgagctcgaccccaacgactcggccgcgacc
cgcctggcctgcacccgcccgttccgcgacggcacagcgctacggcccgaggctgaatgg
gccggtgacggtgtcgtcctggtacagatgaacatccccggctccgaggacatcgcccgc
gaggcggccgtcgagatggcacgcaagatgggcatcaccgacccacaggtatgcaacctg
caagtgctgcaccccgccgaaggatgcttcgttgaggtcaaaggccaggcgacccacgtc
gacgtcaacccatccaagctgacgatccccgagaagatcgaactgctacccgccgacgaa
ctacgccaattcgtcaccgaccacgagttgtcggtggtggccggcactgtcggtgaggac
gagcacagcgtcgggctgcgcgagatcctcgacatcaagcacggtggcatcgagaagtac
ggggtgaaatatcgctaccttggcacatcggtgccggtggaaaagatggtcgatgccgct
atcgagagtggcgccgacgccatcctcatctccacgatcatcagtcacaacgacatccat
cgcaccatgatgcggaagttggctgatctggccaccgagaagggcatccgcgacaaggtc
gttctcgtcgccggcggcacccaggtgaaccgggagatggcagcagagaccggcttggac
gccaccttcgggcgcggcaccaagggcatcgatgtccttgacgccatcgtgcgcactatg
cggacccgcgcggaagcctga

DBGET integrated database retrieval system