KEGG   Candidatus Phytoplasma australiense: PA0489Help
Entry
PA0489            CDS       T00752                                 

Gene name
rluA
Definition
(GenBank) Pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
pal  Candidatus Phytoplasma australiense
Brite
KEGG Orthology (KO) [BR:pal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pal03009]
    PA0489 (rluA)
Enzymes [BR:pal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     PA0489 (rluA)
Ribosome biogenesis [BR:pal03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PA0489 (rluA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: CAM11823
UniProt: B1VA50
Position
487510..488418
Genome map
AA seq 302 aa AA seqDB search
MKATKNFLISEKNKMQRLDHFLVSQTTWNKSQCQKLIAAKKVLVNQKPTKKNYLLKNQDL
ITIPTTVFKTPLNIQKPYNLNLEVVYEDSDLAVINKPSNLIVHPSLSFEGITLVNALLHQ
FSSLSNIDTPRPGIVHRLDKNTTGLMLIAKNDNTSQKLQTAFSQRTIKKVYWGLIEGFLE
NEGTINLPIARNPNDRLKMTVLPNGKEAVTHFKTLKRLNNFSLMQFVLETGRTHQIRAHL
SYLKKPLLGDKLYGSKHYNTDEGQFLHAKELIFKHPISFQEINLQAPLPLNFQKLLDKLT
NL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaactaaaaattttttaatttctgagaaaaataaaatgcaaagattagatcat
tttttagtttcacaaactacttggaataaaagtcaatgtcaaaaattaattgccgctaaa
aaagtgttagtgaatcaaaaaccaactaaaaaaaactatctccttaaaaaccaagattta
ataactatcccaactactgtttttaaaactcctttaaacattcaaaaaccttataatctt
aatttagaagttgtttatgaagattctgatttagctgtcattaacaaaccttctaatttg
attgttcacccttctttgagttttgaaggaattactttagttaacgctttacttcatcaa
ttttcatctttaagcaatattgacacaccaagaccaggaattgttcataggttagataaa
aacactacaggtttgatgttgatagctaaaaatgacaatacgagtcaaaaactacaaaca
gcctttagtcaaagaactattaaaaaagtttattggggtttaatagaaggttttttagaa
aacgaaggaaccattaatttacctattgcaagaaaccccaatgaccgtttaaaaatgaca
gttcttccaaacggtaaagaagcagttactcattttaaaactttaaaacgtttgaataat
ttttctttaatgcaattcgtcttagaaacgggccgcactcaccaaattagagctcattta
tcttatttaaaaaaaccgcttttaggtgataaactttatggatctaaacattataataca
gatgaaggtcaatttttgcacgctaaagaattaatttttaaacatcctattagttttcaa
gaaattaaccttcaagctcctttgcctttaaattttcaaaaattactcgataaactaact
aatctttaa

DBGET integrated database retrieval system