KEGG   Providencia alcalifaciens: CO695_08115Help
Entry
CO695_08115       CDS       T05107                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
pala  Providencia alcalifaciens
Brite
KEGG Orthology (KO) [BR:pala00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CO695_08115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ATG16262
UniProt: A0A291EAS5
Position
complement(1750100..1750477)
Genome map
AA seq 125 aa AA seqDB search
MLNDPNVSIQVQSVYIESQSQPEIARFVFAYTICIRNVGRVPIQLMSRYWLITNSDGRKT
EVQGEGVVGEQPVILPGKEYRYTSGAILETPMGTMEGYYVMLSDQGNHFHVDIPAFRLAI
PTLIN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatgatcccaatgtgagcatccaagttcaaagtgtctacatagaaagccaatcc
caacctgagatcgcccgtttcgtctttgcgtataccatttgtatccgtaatgtagggcga
gtcccgatacagttaatgagccggtattggctcattaccaatagtgatggtcgtaaaact
gaagtgcaaggtgaaggcgtggttggcgaacaacccgtgattttaccgggcaaggaatat
cgctataccagcggtgcaatattagaaacaccaatgggtacgatggaaggctattacgtc
atgctgagcgaccaaggaaatcacttccatgttgatattcctgcatttcgtctcgccatc
ccaacactgattaattga

DBGET integrated database retrieval system