KEGG   Pseudomonas alcaligenes: A0T30_01545Help
Entry
A0T30_01545       CDS       T04318                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
palc  Pseudomonas alcaligenes
Pathway
palc00030  Pentose phosphate pathway
palc00480  Glutathione metabolism
palc01100  Metabolic pathways
palc01110  Biosynthesis of secondary metabolites
palc01120  Microbial metabolism in diverse environments
palc01200  Carbon metabolism
Module
palc_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:palc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A0T30_01545
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A0T30_01545
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:palc04147]
    A0T30_01545
Enzymes [BR:palc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     A0T30_01545
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     A0T30_01545
Exosome [BR:palc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   A0T30_01545
  Exosomal proteins of colorectal cancer cells
   A0T30_01545
  Exosomal proteins of bladder cancer cells
   A0T30_01545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AMR65113
UniProt: A0A142ILD1
Position
323339..324784
Genome map
AA seq 481 aa AA seqDB search
MNSPCDMLVFGGTGDLALHKLLPALYHLHRDGRLPADMRILAAARNVLNRAEYQALAERR
CRAQVARSDFDNDTWASFAARLDYLAMDLSQSAEFGRLARFLGAHACNRGRIYYLATAPD
LFEAIAEHLAIAGLAGSDTRIVLEKPIGRSLESAREINAAIGAVFSEPQVFRIDHYLGKE
TVQNLMALRFANALFEPIWRAGHIDHVQISVNETLGVENRGAYYDKAGAMRDMVQNHLLQ
LLCLVAMEAPVRFDAESVRNEKVKILEALKPIAGLDVHDKTVRGQYVAGKIGGQEVPAYY
FEKHVDNDSDTETFVAIQAEIDNWRWAGVPFYLRTGKRMAKKCSEIVIQFKPVPHRLFEG
SQANRLVISLQPEERITLQLMGKSPGKGMQLTPIELDLNLAQVFPQKRRWDAYERLLLDV
IEGDSTLFMRRDEVEAAWAWIDPILKGWQDNYQDPRPYPAGRNGPEQANTLLELAGREWE
D
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagcccttgtgacatgctggtattcggcggcaccggtgacctggccctgcacaag
ctgctgccggcgctctaccacctgcatcgcgacggccgcctgccggccgatatgcgcatc
ctcgccgcggcacgcaatgtgctgaaccgtgccgagtaccaggccctggccgaacgccgc
tgccgcgcccaggtagcacgcagcgacttcgacaacgacacctgggccagctttgccgcg
cgcctggactacctggccatggacctgtcgcagagcgccgaattcggccgcctggcccgg
ttcctcggcgcccatgcctgcaaccgcgggcgcatctactacctggccaccgcgccggac
ctgttcgaagccatcgccgagcacctggccatcgccgggttggccggcagcgatacgcgt
atcgtgctggagaagccgatcggccgctcgctggagtcggcccgcgagatcaacgccgcc
atcggcgcggtgttcagcgagccgcaggtattccgcatcgaccactacctgggtaaggag
acggtgcagaacctgatggcactgcgcttcgccaatgccctgttcgagccgatctggcgt
gccgggcacatcgaccacgtgcagatcagcgtcaacgagacgctcggcgtggaaaatcgc
ggcgcctactacgacaaggccggcgccatgcgcgacatggtgcagaaccacctgctgcag
ctgctctgcctggtcgccatggaagcgccggtgcgcttcgacgccgagtcggtgcgcaat
gaaaaggtgaagatcctcgaagcgctcaaacccatcgccggcctcgacgtgcacgacaag
acggtgcgcggccagtacgtcgccgggaagatcggcgggcaggaagtgccggcgtactac
ttcgagaaacatgtcgacaacgacagtgataccgaaaccttcgtcgccattcaggccgag
atcgacaactggcgctgggccggcgtgcccttctacctgcgtaccggcaagcgcatggcg
aaaaagtgctcggagatcgtcatccagttcaagccggtgccgcaccgcctgttcgaaggc
agccaggccaaccgcctggtcatcagcctgcagccggaggaacgcatcaccctgcagctg
atgggcaagagcccgggcaaaggcatgcagctgacccccatcgaactggacctgaacctg
gcccaggtgttcccgcagaaacgccgctgggatgcctacgagcgcctgctgctggacgtg
atcgaaggcgactcgacgctgtttatgcgcagggacgaagtggaggcggcctgggcctgg
atcgaccccatcctcaagggctggcaggacaactaccaggacccgcgcccctaccccgcc
ggccgcaacggcccggaacaggccaacaccctgctggagctggccgggcgcgagtgggaa
gactag

DBGET integrated database retrieval system