KEGG   Pseudomonas alcaligenes: A0T30_09005Help
Entry
A0T30_09005       CDS       T04318                                 

Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
palc  Pseudomonas alcaligenes
Pathway
palc00860  Porphyrin and chlorophyll metabolism
palc01100  Metabolic pathways
Module
palc_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:palc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A0T30_09005
Enzymes [BR:palc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     A0T30_09005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AMR66496
UniProt: A0A142IQB4
Position
1973721..1974293
Genome map
AA seq 190 aa AA seqDB search
MTLSLDMLRHGVTDGGPGFRGSSDDALTEQGRQQMQLALAGKGGWDLVISSPLQRCESFA
REFAEANGLPLRIEADLRELHFGAWEGRNSAQVLLEDPEALGQFWNDPYNFTPPEAEPVR
DFAARVLGAVERLQAELDGQRVLLVTHGGVMRLLLARARNLPENQLLQVEVGYGALHGLQ
VEPGLQLTEA
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgacgctttccctggacatgttgcgccatggcgtaaccgatggcggccccggtttccgt
ggcagcagtgacgacgccctgaccgagcagggccgccagcagatgcagctggccctggcc
ggcaaaggcggctgggacctggtgatcagctcgccattgcagcgctgcgagagcttcgcc
cgcgagtttgccgaggccaatggcctgccgctgcgcatcgaggccgacctgcgcgagctg
cacttcggcgcctgggaagggcgcaactcggcgcaggtgctgctcgaggacccggaggcg
ctcggccagttctggaacgatccctataacttcaccccgcccgaagccgagccggtacgt
gacttcgccgcacgcgtgctcggtgccgtcgagcgcctgcaggccgagctggacggtcag
cgcgtgctgctggtgactcacggcggggtgatgcgcctgctgctggcgcgcgcgcgcaac
ctgccggaaaaccagctgctgcaggtggaagtgggctacggcgcactgcacggcctgcag
gtcgagccgggtctgcaactgaccgaagcctga

DBGET integrated database retrieval system