KEGG   Pseudomonas alcaligenes: A0T30_09025Help
Entry
A0T30_09025       CDS       T04318                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
palc  Pseudomonas alcaligenes
Pathway
palc00480  Glutathione metabolism
palc00590  Arachidonic acid metabolism
palc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:palc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    A0T30_09025
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A0T30_09025
Enzymes [BR:palc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     A0T30_09025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AMR66500
UniProt: A0A142IQB8
Position
1976956..1977507
Genome map
AA seq 183 aa AA seqDB search
MLSRTVAISLLCLLSAPVLAADCPPLLKAQGELQQLRSKERIDLCQRFAGKPLLVVNTAS
RCGFTPQFKGLEALYQRYKGQGLEVLGVPSDDFRQEADDSAETAKVCFIDYGVTFAMSEP
QVVSGEAAAPLFRELAAQSSAPRWNFYKYVVGRDGKVIASFSSLTKPDDAALIEAIDKAI
AQP
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgcgtaccgttgccatttcactgctgtgcctgctgtctgcgcccgtgttggcg
gccgattgcccgccactgctgaaggcgcagggcgagttgcagcaattgcgctccaaggag
cgcatcgacctctgtcagcgtttcgccggcaagccgctgctggtggtcaacaccgccagc
cgttgcggcttcacgccgcagttcaagggcctggaggcgctctaccagcgctacaagggc
cagggcctggaagtgctgggtgtgccgtcggatgacttccgtcaggaggcggacgattcc
gcggagacggccaaggtgtgtttcatcgactacggcgtgaccttcgccatgagcgagccg
caggtggtcagcggtgaggcggccgcgccgctgttccgcgagctggctgcgcagagcagt
gcgccgcgctggaacttctacaagtacgtggtggggcgtgacggcaaggtgatcgccagt
ttctccagcctgaccaagccggacgacgcggccctgatcgaggcgatcgacaaggccatc
gcccagccgtga

DBGET integrated database retrieval system