KEGG   Pseudomonas alcaligenes: A0T30_11865Help
Entry
A0T30_11865       CDS       T04318                                 

Definition
(GenBank) 23S rRNA (cytidine(2498)-2'-O)-methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
palc  Pseudomonas alcaligenes
Brite
KEGG Orthology (KO) [BR:palc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:palc03009]
    A0T30_11865
Enzymes [BR:palc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     A0T30_11865
Ribosome biogenesis [BR:palc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    A0T30_11865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: AMR67028
UniProt: A0A142IRU6
Position
2566410..2567459
Genome map
AA seq 349 aa AA seqDB search
MNTLLLHCRSGFEGEVCAEISDQAARLGVAGYAKAKPNSAHAEFTCLEPGGAELLMQGQR
FNRLIFPRQWARGDYLQLPETDRISVLLQALASYPVCGSLWLEVFDTNDGKELSNFCKKF
EGPLRKALEKAGRLVEDASKPRLLLTFKSGREVFLGMAEADNQASWPMGIPRLKFPREAP
SRSTLKLEEAWHFFIPREQWDARLSDEMTGVDLGAAPGGWTYQLVRRGMLVTAIDNGPMA
ESLMDTGLVTHLMVDGFTWKPRQPVDWMVCDIVEKPARTAAMVEEWIGGGHCREAVVNLK
LPMKQRYAEVCKLLQRLQDAFAERRIKVAIACKQLYHDREEVTCHLRRL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaataccctactgctgcactgccgttccggtttcgagggcgaggtctgcgccgagatc
agcgaccaggccgcgcgcctgggcgtggccggctatgccaaggccaagccgaacagtgcc
catgccgaattcacctgcctggagcccggcggcgccgagcttctgatgcagggccagcgt
ttcaaccggctgatcttcccgcgccagtgggcccgcggtgattacctgcagctgccggaa
accgatcgcatcagcgtgctgctgcaggccctggccagctacccggtatgcggcagcctg
tggctggaggtgttcgataccaacgacggcaaggagctgtcgaacttctgcaagaagttc
gaggggccgctgcgcaaggcgctggagaaggccggtcggctggtggaggacgcgagcaag
ccgcgtctgctgctgaccttcaagagcggccgtgaggtgtttctcggcatggccgaggcc
gataaccaggcgtcctggccgatgggcatcccgcgtctgaaattcccgcgcgaggcgccg
agccgctccaccctcaagctggaggaggcctggcacttcttcatcccgcgcgagcagtgg
gacgcgcgcctgtccgacgagatgactggcgtcgaccttggcgcggcccctggcggctgg
acctaccaactggttcgccgtggcatgctggtcaccgccatcgacaacgggccgatggcc
gagagcctgatggacaccggcctggtcacccacctgatggtcgacggcttcacctggaag
cccaggcagccggtggactggatggtctgtgacatcgtcgagaagccggcccggaccgcg
gcgatggtcgaggagtggataggtgggggccactgtcgcgaggcggtggtcaacctgaaa
ctgccgatgaagcagcgctacgcggaggtgtgcaagctgctgcagcgtttgcaagacgcc
ttcgcggagcggcgcatcaaggtcgccatcgcctgcaagcagctctatcacgaccgcgag
gaagtgacctgccatctgcgccgcctttag

DBGET integrated database retrieval system