KEGG   Pseudomonas alcaligenes: A0T30_17075Help
Entry
A0T30_17075       CDS       T04318                                 

Definition
(GenBank) 5'/3'-nucleotidase SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
palc  Pseudomonas alcaligenes
Pathway
palc00230  Purine metabolism
palc00240  Pyrimidine metabolism
palc00760  Nicotinate and nicotinamide metabolism
palc01100  Metabolic pathways
palc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:palc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A0T30_17075
   00240 Pyrimidine metabolism
    A0T30_17075
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    A0T30_17075
Enzymes [BR:palc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     A0T30_17075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: AMR67997
UniProt: A0A142IUL5
Position
complement(3714359..3715108)
Genome map
AA seq 249 aa AA seqDB search
MRILISNDDGVMAPGIAALYDALADYAECLVIAPSEDKSGASSSLTLDRPLHPATLPNGF
VALNGTPTDCVHLGLNALLDPLPDMVVSGINLGANLGDDVLYSGTVAAALEGRFLSKPAF
AFSLVSRQTTNLPTAAYFARKLVEAHDKLDLPPRTVLNVNVPNLPLEHIRGVQLTRLGHR
ARAAAPVKQVNPRGKEGYWISVSGDAEDGGPGTDFHAVMQGYVSITPLQLDRTFHEAFAG
LDGWLEGLL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattctgatctccaacgacgacggggtaatggcgcccggtatcgccgcgctgtac
gacgcactggccgactatgccgagtgcctggtcatcgcgccgagcgaagacaagagcggt
gccagcagctcgctgaccctggaccggccgctgcatccggcgaccctgcccaacggtttc
gtcgcgctcaacggcacgccgaccgactgtgtgcacctgggcctcaatgcgttgctcgac
ccgctgccggacatggtggtgtcgggcatcaacctgggcgccaacctaggtgacgacgtg
ctgtattccggcaccgtggccgccgccctggaagggcgcttcctgagcaagccggcgttc
gccttttcgctggtgtcgcggcagacgaccaacctgccgacggcggcctacttcgcccgc
aagctggtcgaggcgcacgacaagctcgacctgccgccgcgcaccgtgctcaacgtcaac
gtgcccaacctgccgctggagcacatccgcggcgtgcagctgacccgcctggggcatcgc
gcgcgcgccgccgcgccggtgaagcaggtcaacccgcgcggcaaggagggctactggatc
tccgtttccggcgatgccgaggacggcggcccgggcaccgatttccacgcggtgatgcag
ggttatgtctccattaccccgttgcagctggaccgtaccttccacgaggctttcgccggg
ctggacggctggctggagggcctgctctga

DBGET integrated database retrieval system