KEGG   Pseudomonas alcaligenes: A0T30_17315Help
Entry
A0T30_17315       CDS       T04318                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
palc  Pseudomonas alcaligenes
Pathway
palc00071  Fatty acid degradation
palc00072  Synthesis and degradation of ketone bodies
palc00280  Valine, leucine and isoleucine degradation
palc00310  Lysine degradation
palc00362  Benzoate degradation
palc00380  Tryptophan metabolism
palc00620  Pyruvate metabolism
palc00630  Glyoxylate and dicarboxylate metabolism
palc00640  Propanoate metabolism
palc00650  Butanoate metabolism
palc00900  Terpenoid backbone biosynthesis
palc01100  Metabolic pathways
palc01110  Biosynthesis of secondary metabolites
palc01120  Microbial metabolism in diverse environments
palc01130  Biosynthesis of antibiotics
palc01200  Carbon metabolism
palc01212  Fatty acid metabolism
palc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:palc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A0T30_17315
   00630 Glyoxylate and dicarboxylate metabolism
    A0T30_17315
   00640 Propanoate metabolism
    A0T30_17315
   00650 Butanoate metabolism
    A0T30_17315
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A0T30_17315
   00072 Synthesis and degradation of ketone bodies
    A0T30_17315
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A0T30_17315
   00310 Lysine degradation
    A0T30_17315
   00380 Tryptophan metabolism
    A0T30_17315
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A0T30_17315
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A0T30_17315
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A0T30_17315
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:palc04147]
    A0T30_17315
Enzymes [BR:palc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A0T30_17315
Exosome [BR:palc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A0T30_17315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AMR68042
UniProt: A0A142IUR0
Position
3760320..3761504
Genome map
AA seq 394 aa AA seqDB search
MQDAVIVSTARTPIAKAFRGAFNDLKSPSMAAVALRAAVERAGIEPGEIEDVVMGTAMQG
GTASTNLGRLSLLAAGLPLAVSGQTIDRQCASGLMAISIAAKQIMVDGMAVTVGAGQEQI
SLVQNTHMKWTAAEADPAVIKMAEHAYMPMLQTAELVAKRYGISREAQDAYSLQSQQRTA
AAQAAGLFANEIVPVKARKKLVDKETGAVSFEEVILSLDEGNRPQTVLDDLTKLKPVIEG
GCITAGNASQLSDGASACVLMSGALAAQRGIAPLGLYRGIAVAGLAPEEMGIGPVFAVPK
LLKQHGLSVDDIGLWELNEAFACQVLYSAQKLGIDPAKLNVNGGAISIGHPYGMSGARMV
GHALLEGKRRGVKYVVITMCVGGGMGAAGLFEVL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgccgtcatcgtctccaccgcccgcacaccgatcgccaaggccttccgcggc
gcgttcaacgacctcaagtcgccgtccatggccgccgtcgctctgcgcgccgcggtggag
cgcgccggcatcgagccgggcgaaatcgaggacgtagtgatgggcaccgccatgcagggc
ggcaccgcctccaccaacctcggccgcctgtcgctgctggccgccggcctgccgctggcg
gtcagcgggcagaccatcgaccgccagtgcgcctcgggcctgatggcgatctccatcgcc
gccaaacagatcatggtcgacggcatggccgtgaccgtcggtgccggccaggagcagatc
agcctggtgcagaacacccacatgaagtggaccgccgccgaggccgacccggccgtgatc
aagatggccgagcacgcctatatgcccatgctgcagaccgccgagctggtggccaagcgc
tacggcatcagccgcgaggcgcaggacgcctactcgctgcagtcccagcagcgcaccgcc
gcggcccaggctgcaggcctgttcgccaatgaaatcgtcccggtcaaagcacgcaagaaa
ctggtggataaagaaaccggcgcggtcagcttcgaggaagtgatcctcagcctggacgaa
ggcaaccgcccgcagaccgtgctggacgacctgaccaagctcaagccggtcatcgaaggc
ggctgcatcaccgccggtaacgccagccagctgtccgacggcgccagcgcctgcgtactg
atgagcggcgccctggccgcccagcgtggcatcgccccgctgggcctgtaccgtggcatc
gccgtggccggcctggccccggaagagatgggtatcggcccggtattcgccgtgccgaaa
ctgctcaagcagcacggtctgagcgtcgacgacatcggcctgtgggagctcaacgaagcc
ttcgcctgccaggtgctgtacagcgcgcagaaactcggcatcgatccggccaagctcaac
gtcaacggcggcgccatctccatcggccacccgtacggcatgagcggcgcgcgcatggtc
ggccatgccctgctggaaggtaagcgccgtggcgtgaagtacgtggtgatcaccatgtgc
gtcggcggcggtatgggcgcggcagggctgttcgaggtgctctga

DBGET integrated database retrieval system