KEGG   Pteropus alecto (black flying fox): 102878481
Entry
102878481         CDS       T02993                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale05200  Pathways in cancer
pale05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102878481 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102878481 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102878481 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102878481 (MECOM)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    102878481 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 zf-met zf-C2H2_11 Zn-ribbon_8 PyrI_C
Other DBs
NCBI-GeneID: 102878481
NCBI-ProteinID: XP_015444047
Position
Unknown
AA seq 1192 aa
MLSSHIQRSIHSKRGLSLQSPHLHPRXXXXXXFELRESNMPGAGLGIWTKRKIEAGEKFG
PYVGEQRSNLKDPSYGWEILDEFCNVKFCIDASEPDVGSWLKYIRFAGCYDQHNLVACQI
NDQIFYRVVADIAPGEELLLFMKSEDYPHDPMAPDIHEERQYRCEDCDQLFESKAELADH
QKFPCSTPHSAFSMVEEDFQQKLESENDLREIHAIQECKECDQVFPDLQSLEKHMLSHTE
EREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARA
HACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKC
KDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLA
DYFGANRHPAGLTFPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSP
LMTHPQILPATQDILKALSKHPPVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVST
PSGSDLETTSGSDLESDIESDKEKFKENGKMFKDKVSPLQNLASIHNKKEYSNHSIFSPS
LEEQTAVSGAVNDSIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSM
YPFPDRDLRSLPLKMEPQSPSEVKKLQKGSSESPFDLTTKRKDEKPLTPVPSKPPATPAT
SQDQPLDLSMGSRSRASGTKLTEPRKNHVFGEKKGSNLEPRPASDGSLQHARPTPFFMDP
IYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKP
DASELLQSVPSMFNFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQ
PYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSG
TATSSPHSELESTGAILDDKEDAYFTEIRNFIGNSNHSSQSPRNTEERMNGSHFKDEKAL
VTSQNSDLLDDEEVEDEVLLDEEDEDNDITVKTGKEPVTSNLHEGNPEDDYEETNALEMS
CKTSPVRYKEEEYKTGLSALDHIRHFTDSLKMRKMEDNQYTEAELSSFSTSHVPEELKQP
LHRKSKSQAYAMMLSLSEKESLHSTSHSSSTVWHSMARAAAESSAIQSISHV
NT seq 3579 nt   +upstreamnt  +downstreamnt
atgctctccagccacatccagcgaagcattcactccaaaagagggctctccttacaaagc
ccccatctacatcccagatnnnnnnnnnnnnnnnnntttgaacttcgagagtcaaatatg
cctggagcgggactaggaatatggaccaaaaggaagatcgaagcaggggaaaagtttggg
ccctatgtgggagagcagaggtcaaacctgaaagaccccagttatggatgggagatctta
gatgagttttgcaatgtgaagttctgcatagatgctagtgaaccagatgtaggaagctgg
ctcaagtacatcaggttcgctggctgttatgatcagcacaacctcgttgcatgccagata
aatgatcagatattttatagagtagtcgcagacattgcaccgggagaggagctcctgctg
ttcatgaagagtgaagactatccccatgaccccatggcgcccgacatccacgaagaacgg
caatatcgctgtgaggactgtgatcagctctttgagtccaaggctgaactagcagatcac
cagaagttcccgtgcagtacccctcattcagcattttcaatggtggaagaagactttcaa
caaaaactcgaaagtgaaaatgatctccgagagatacatgcaatccaggagtgtaaggaa
tgtgaccaagtttttcccgatttgcaaagcctggagaaacacatgttgtcacatactgaa
gagagggaatacaagtgcgatcagtgtcccaaggcatttaactggaagtccaacttaatt
cgccaccagatgtcacatgacagtggaaagcactatgaatgtgaaaattgtgccaaggtt
ttcacggaccctagcaaccttcagcggcacattcgctctcagcacgttggtgcccgggcc
cacgcatgcccggagtgtggcaaaacgtttgccacttcgtcgggcctcaaacaacacaag
cacatccacagcagtgtgaagccctttatctgtgaggtctgccataaatcctatactcag
ttttcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgc
aaagactgtggacaaatgttcagcactacgtcttccttaaataaacacaggaggttttgt
gagggcaagaaccattttgcggcaggtggattttttggccaaggcatttcacttcctgga
accccagctatggataaaacgtccatggttaatatgagtcatgccaacccgggccttgct
gactattttggtgccaataggcatcctgctggtcttacctttccaacagctcctggattt
tcttttagcttccctggtctgtttccttccggcttgtaccataggcctcctttgatacct
gctagttctcctgttaaaggactatcaagtactgaacagacaaacaaaagtcaaagtccc
ctcatgacacatcctcagatactgccagctacacaagatattttgaaggcactatctaaa
cacccacctgtaggggacaataagccagtggagctccagcccgagaggtcctctgaagag
aggccccttgagaaaatcagtgaccagtcagagagtagtgaccttgatgatgtcagtacg
ccaagtggcagtgacctggaaacaacctcgggctctgatctggaaagtgacattgaaagt
gataaagaaaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagccctcttcag
aatctggcttcaatacataataagaaagaatacagcaatcattccattttctcaccatct
ttagaggagcaaactgcggtgtcaggagctgtgaatgattctataaaggctattgcttct
attgctgaaaaatactttggttcaacaggactggtggggctgcaagacaaaaaagttgga
gctttaccttacccttccatgtttcccctcccgttttttccagcattctctcaatcaatg
tacccatttcctgatagagacttgaggtcgttacctttgaaaatggaaccccaatcacca
agtgaagtaaagaaactgcagaagggaagctctgagtctccctttgatctcaccactaag
cgaaaggatgagaaacccttgactccagtaccctccaagcctccagccactcctgccaca
agtcaagaccagcccctggatctaagtatgggcagtaggagtagagccagtgggacaaag
cttactgagcctcgaaaaaaccacgtatttggggaaaagaaaggaagcaaccttgaacca
agaccggcatcagatggttccttgcagcatgctagacccactcctttctttatggaccct
atttacagagtagaaaaaagaaaactaactgacccacttgaagctttaaaagagaaatac
ttgagaccttctccaggattcttatttcacccacaattccaactgcctgatcagagaact
tggatgtcagctattgaaaacatggcggagaagctagagagcttcagtgccctgaaacct
gatgccagtgaacttctacagtcagttccctccatgttcaacttcagagcgcctcccaat
gcccttccagagaaccttctacggaaaggaaaagaacgctatacctgcagatactgtggc
aagatttttccaaggtctgcaaacctaacacggcacttgagaactcatacaggagagcag
ccttacagatgcaaatactgtgacagatcatttagcatatcttctaacttgcagcggcat
gttcgcaacatccacaataaggagaagccctttaagtgtcacttatgtgataggtgtttc
ggtcaacagaccaacttagacagacacctaaagaaacatgagaatgggaacatgtctggt
acagcaacatcgtcgcctcattctgaactggaaagtacaggtgcaattctcgatgacaaa
gaagatgcttacttcacagaaattcgaaatttcattgggaatagcaaccacagcagccag
tctcccaggaatacagaggagagaatgaatggcagtcactttaaggatgaaaaggcttta
gtgacgagtcaaaattcagatttactggatgatgaagaagtagaagatgaggtgttgtta
gatgaggaggatgaagacaatgatattactgtaaaaacaggaaaggaaccagtgacaagt
aatttacatgaaggaaaccctgaggatgactatgaagaaaccaacgccctggagatgagt
tgcaagacttctccagtgaggtataaagaggaagaatacaaaactggactttctgctcta
gatcatataaggcacttcacagatagcctcaaaatgaggaaaatggaagataatcaatat
actgaagctgagctctcttcttttagtacttcccatgtgccagaggaacttaaacagccg
ttacacagaaagtccaaatcacaggcatatgctatgatgttgtcattgtctgagaaggag
tccctccattctacatcccacagttcttccaccgtgtggcacagtatggcaagggccgca
gcagaatccagtgccattcagtctataagccacgtatga

DBGET integrated database retrieval system