KEGG   Pteropus alecto (black flying fox): 102878596Help
Entry
102878596         CDS       T02993                                 

Gene name
ABHD12
Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X1
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
pale  Pteropus alecto (black flying fox)
Brite
KEGG Orthology (KO) [BR:pale00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pale01002]
    102878596 (ABHD12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pale04147]
    102878596 (ABHD12)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102878596 (ABHD12)
Peptidases [BR:pale01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   102878596 (ABHD12)
Exosome [BR:pale04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102878596 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 Thioesterase Peptidase_S15 Chlorophyllase2 Say1_Mug180 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 102878596
NCBI-ProteinID: XP_006921564
Position
Unknown
AA seq 398 aa AA seqDB search
MRKRTEPVALEHEPCAVSGSTSSGSAAAVLDTDCSLKRKLCLAGRGPGETRSAADADMKR
ALGRRKGLWFRLRKILLYVLGLYIAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQ
GLNHTCNYYLQPEEDITIGVWHTVPTVWWKTAQGKDQMWYEDALASSYPIILYLHGNAGT
RGGDHRVELYKVLSSLGYHVVTFDYRGWGDSIGTPSERGMTYDALHVFDWIKARSGDNPV
YIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWF
FLDPITSSGIKFANDENVKHISCSLLILHAEDDPVVPFQLGRKLYNIAAPSQSFRDFKVQ
FIPFHSDLGYRHKYIYKSPELPRILREFLGNSEPEHQH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcggaccgagcccgtcgccttggagcatgagccctgcgccgtctcgggctcg
acttcctccggctcggccgccgcggtgctggacaccgactgcagcctgaagcggaaactg
tgcctggcgggcaggggaccgggcgagacgcgcagcgccgcggacgcggacatgaagcgg
gcgctaggcaggcgaaagggcctgtggttccgactgaggaagatacttctctatgttttg
gggttatacattgccattccatttctcatcaaactatgtcctgggatacaggccaaactg
attttcttgaattttgtgagggttccctatttcattgacttgaaaaaaccacaggatcaa
ggtttgaatcacacctgcaattactacctccagccagaggaagatataaccattggagtc
tggcacactgtccccactgtctggtggaagactgcccaagggaaggaccagatgtggtac
gaggatgccttggcttccagttaccctatcatcctgtacctgcatgggaatgcaggtacc
agaggaggtgaccaccgagtggaactttacaaggtgctgagttcccttggttaccacgtg
gtcacttttgactatagaggttggggtgactcaataggcacgccatcagagcggggcatg
acctatgatgcactccatgtttttgactggattaaagcgagaagtggagacaaccccgtg
tatatttggggccactccctaggcactggagtggcaacaaatctggtgcggcgcctctgt
gagcgagagacacctccagatgccctaatattggaatctccattcaccaatattcgtgaa
gaagctaagagccatccgttctcagtgatatatcgatatttccctggatttgactggttc
ttccttgatcccattacaagcagtggaattaaatttgcaaatgatgaaaatgtgaagcac
atctcctgctccctgctcatcttgcacgctgaggatgacccagttgtgcccttccagctt
ggcagaaagctctacaacattgctgcaccctctcagagcttccgagacttcaaagttcag
tttatcccctttcactcagacctcggctacaggcacaagtacatctacaagagccctgag
cttcctcgaatactaagggaattcctggggaattcggaacctgagcaccagcactga

DBGET integrated database retrieval system