KEGG   Pteropus alecto (black flying fox): 102878752Help
Entry
102878752         CDS       T02993                                 

Gene name
CTSO
Definition
(RefSeq) cathepsin O
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04142  Lysosome
pale04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102878752 (CTSO)
  09143 Cell growth and death
   04210 Apoptosis
    102878752 (CTSO)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pale01002]
    102878752 (CTSO)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     102878752 (CTSO)
Peptidases [BR:pale01002]
 Cysteine Peptidases
  Family C1: papain family
   102878752 (CTSO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Peptidase_C1_2 Inhibitor_I29
Motif
Other DBs
NCBI-GeneID: 102878752
NCBI-ProteinID: XP_006917092
UniProt: L5KCT7
Position
Unknown
AA seq 393 aa AA seqDB search
MMKPESTWTYARCFYPAKEENLSSRLSEQRELRQRQSAGPHTPDWSPAQQTRRGGGAEES
KGKPTRAGGCGMALRALWHLWLLGCCWCCGSGRGAGPGPTFARPGPRSRERQAAAFRESL
NRHRYLNSLFPSENSTAVYGINQFSHLFPEEFKAIYLKSKTSRFPKYSADLLTVISKLPL
PLRFDWRDKHVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNY
GCNGGSTLNALYWLNKTQVKLVRDSEYPFKAQNGLCLYFADTHSGFSIKGYSAHDFSDQE
DEMAKALLTFGPLVGIVDAVSWQDYLGGIIQHHCSSGEANHAVIITGFDKTGSTPYWIVR
NSWGSSWGVDGYAHVKMGDNTCGIADFVSAVFI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaccagaaagcacgtggacatatgcccgatgcttctaccccgcaaaagaagag
aatctcagttctcggttaagtgagcaaagggaactgaggcagcgtcagtctgcaggaccg
cacaccccagactggtctcccgcccagcaaacccggcgaggaggcggagcggaggaatcg
aaagggaaaccgacgcgggcgggcggctgcggtatggcgctgcgggccctgtggcacctc
tggctgcttggctgctgctggtgctgcggcagtggccgtggagccggtcccggtcccacc
ttcgcccgccctggaccgcggagccgcgagcgacaggcagccgccttccgggaaagtctt
aatagacatcgatacttgaattctttatttcctagtgaaaattctactgctgtttatgga
ataaatcagttttcgcacttgtttcctgaagagtttaaagctatttatttaaaaagcaaa
acttccagatttcctaaatactcagcagacctgctaacagtcatctccaagctgcctttg
ccattaagatttgactggagagataagcatgttgtaacacaagtgagaaaccagcagatg
tgcggagggtgctgggccttcagtgtggtaggtgccgtggaatcagcgtatgcaataaaa
gggaagcctttggaagacctcagtgtgcagcaggtcattgattgttcatataataattac
ggctgcaacggagggtctactctcaatgccttgtactggctaaataagacgcaagtgaaa
ctggtgagggattcagaatacccgtttaaagcacagaatggtctgtgcctttactttgct
gatacacactctggattctcaatcaaaggttattctgcacatgacttcagtgaccaagaa
gacgaaatggcaaaagcacttcttacctttggccctttggtagggatagtagatgcagtg
agctggcaagattatctgggaggcataatacagcatcattgctctagtggagaagcaaat
catgcagttatcataactgggtttgataaaacaggaagtactccgtattggattgtgcgg
aactcatgggggagttcgtggggagtagatggctatgcccatgttaaaatgggagataat
acttgtggtattgcagatttcgtttccgccgtatttatatga

DBGET integrated database retrieval system