KEGG   Pteropus alecto (black flying fox): 102879172
Entry
102879172         CDS       T02993                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
pale  Pteropus alecto (black flying fox)
Brite
KEGG Orthology (KO) [BR:pale00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pale01009]
    102879172 (AKAP5)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     102879172 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 102879172
NCBI-ProteinID: XP_006915179
UniProt: L5KGG1
Position
Unknown
AA seq 429 aa
METTVSEIQVESKDEKRSAEVSPQNERQEEKASMLCFKRRKKSAKATKPKAGSEAANVTR
TCPPEARASDQPQPPGRAWASLKRLVTRRKRSDSSKQQKPFEAKVQTEINTEDADLSKKK
AKSRLKIPCIKFSKGEKRRNHSKIIEDADCSVKVQGEAERLDTKTMTQSDDQATKTKSTQ
DVSGGVSQKEGDEVCESNVSNSITSPGEKVISVELGLDPEHSAIQTGTLILEKGIENIEE
KQSVQPQQASPLETSETEHQLPVVSDAPPSPAISDQQIVEEARNSILESEPNWKDYESGE
TVDEESKPKNTELSQESDFKEIEISAEKPIPEESKRMEPIAIIITDTEISEFDVKKSKNV
PKQFLISIENEQVGVFANDSGFEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASD
DNKINNLLQ
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggagaccacagtttctgaaattcaagtagaaagcaaagatgagaagagatcagcagaa
gtcagtcctcagaatgagaggcaggaggaaaaagcatcaatgctttgcttcaagagaaga
aagaaatcagccaaagcaacgaagcccaaagctggctctgaagctgctaatgtgacaagg
acatgcccaccagaagcaagagcttctgatcagccacaacccccagggcgggcctgggcc
tccctcaaacgacttgtaactcgcagaaaaaggtcagattcttcaaagcagcaaaagccc
tttgaggctaaagtacaaactgaaatcaatactgaggatgctgatctttctaagaaaaag
gcaaaatccagacttaagattccctgcataaaattctcaaagggagagaaaagacgtaat
cattccaaaattatagaagatgcagactgcagcgtcaaagttcagggagaggctgaaagg
ttggatacaaaaacgatgacccaatcagacgaccaggcaacaaagaccaagtccacccag
gatgtaagtggaggtgtctcacagaaagagggtgatgaggtctgtgaatcaaatgtgagc
aacagtataacttctcctggagagaaagtgatttcagtagaacttgggttagatccagag
cattctgctattcaaacaggaactctaatccttgaaaaaggtattgaaaacattgaggaa
aaacaaagtgtccaaccccagcaagcaagcccacttgaaacttcagaaacagaacatcaa
ctaccagtggtttctgatgctcctccttcacctgcaatctcagatcaacaaattgtggaa
gaagccagaaacagtatcctagaaagtgaaccaaattggaaagactatgaaagtggagag
actgtagatgaggagagtaagccaaaaaatactgaattgagtcaggaatcagattttaaa
gaaattgagatcagtgcagagaaacccataccagaagaaagcaaaagaatggagccaatt
gctattattattacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtc
ccgaagcaattcttaatttcaattgaaaatgagcaagtcggggtttttgctaatgatagt
ggttttgagggtagaacttcagaacaatatgaaacacttttaatagaaacagcttcttct
cttgtcaagaatgctatccagttgtctatagaacagttagttaatgaaatggcctctgat
gataataaaataaacaatcttctacagtga

DBGET integrated database retrieval system