KEGG   Pteropus alecto (black flying fox): 102879346Help
Entry
102879346         CDS       T02993                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04072  Phospholipase D signaling pathway
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04520  Adherens junction
pale04910  Insulin signaling pathway
pale04913  Ovarian steroidogenesis
pale04923  Regulation of lipolysis in adipocytes
pale04930  Type II diabetes mellitus
pale04931  Insulin resistance
pale04932  Non-alcoholic fatty liver disease (NAFLD)
pale04960  Aldosterone-regulated sodium reabsorption
Module
pale_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102879346 (INSR)
   04015 Rap1 signaling pathway
    102879346 (INSR)
   04010 MAPK signaling pathway
    102879346 (INSR)
   04066 HIF-1 signaling pathway
    102879346 (INSR)
   04068 FoxO signaling pathway
    102879346 (INSR)
   04072 Phospholipase D signaling pathway
    102879346 (INSR)
   04022 cGMP - PKG signaling pathway
    102879346 (INSR)
   04151 PI3K-Akt signaling pathway
    102879346 (INSR)
   04152 AMPK signaling pathway
    102879346 (INSR)
   04150 mTOR signaling pathway
    102879346 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102879346 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102879346 (INSR)
   04923 Regulation of lipolysis in adipocyte
    102879346 (INSR)
   04913 Ovarian Steroidogenesis
    102879346 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102879346 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    102879346 (INSR)
   04213 Longevity regulating pathway - multiple species
    102879346 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102879346 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102879346 (INSR)
   04931 Insulin resistance
    102879346 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102879346 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:pale04090]
    102879346 (INSR)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102879346 (INSR)
Protein kinases [BR:pale01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   102879346 (INSR)
CD molecules [BR:pale04090]
 Proteins
  102879346 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 102879346
NCBI-ProteinID: XP_015448954
Position
Unknown
AA seq 1341 aa AA seqDB search
AAGHLYPGEVCPGMDIRNNLTRLHELANCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMI
TDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYSLMNITRGSV
RIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQ
FVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSEPGDPTKCTACRNFYLDGRC
VETCPPPYYHFQDWRCVNFSFCLHLHNKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSS
NLMCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEAN
LGLIEEISGYLKIRRSYALVSLAFFRKLRLIRGDTLEVGNYSFYALDNQNLRQLWDWSKH
HLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSN
IRTSFDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPP
LRSNDPKSQSHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSV
PLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELYELDYCLKGLKLPSRT
WSPPSESEGSQKHNQSEYDDAAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPR
PSRKRRALGDVENVTTVAPTAPSFPNTSWTSVPTSLEEHRPFEKVVNKESLVISGLRHFT
GYRIELQACNQDAPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKE
PNGLIVLYEVSYRRYGDEELHLCVSRRHFALERGCRLRGLPPGNYSVRVRATSLAGNGSW
TEATYFYVTDYHVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNP
EYLSASDVFPCSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNAKDIIKGEAETRVAVK
TVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRS
LRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGD
FGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTASSDMWSFGVVLWEITSLAEQPY
QGLSNEQVLKFVMDGGYLDQPDNCPERLTELMRMCWQFNPKMRPTFLEIVDLLKDDLHPS
FPEVSFFHSEENKAPESEELEMEFEDMESVPLDRSSHSQREEDGGSTLGLKRNYEDHVPY
THMNGGKKNGRVLTLPRSSPS
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
gccgccggccatctgtaccccggagaggtatgtcccggcatggatatccggaacaacctc
acgaggctgcacgagctggccaactgctcggtcatcgaaggacatttgcagatactgttg
atgttcaaaacgaggcctgaggacttccgagacctcagtttccccaaactcatcatgatc
actgattacttgctgctcttccgggtctatgggctggagagcctgaaggacctgttcccc
aacctcacggtcatccggggctcccgtctcttcttcaactacgcgctggtcatcttcgag
atggttcacctgaaggagcttggcctctacagcctgatgaacatcacccggggctctgtc
cgcatcgagaagaacaatgagctctgttacctggccaccatcgactggtcacgcatcctg
gattcggtggaggataattacatcgtgctgaacaaggacgacaacgaggagtgtggggac
atctgtccaggcactgcgaagggcaagaccaactgccctgccaccgtcatcaacgggcag
tttgtggagcggtgttggactcacagccattgccagaaagtctgcccgaccatctgtaaa
tcgcacggctgcaccgccgaaggcctctgctgccacagcgagtgcctgggcaactgctcc
gagcccggcgaccccaccaagtgcacggcctgccgcaacttctacctggacggccggtgt
gtggagacctgcccgcccccgtactaccacttccaggactggcgttgcgtgaacttcagc
ttctgcctgcacctgcacaacaaatgcaagaactctcggaggcagggctgccaccagtat
gtcattcacaataataagtgcatccctgaatgtccctccggatacacgatgaattccagc
aacctgatgtgcactccgtgtctaggcccttgtcccaaggtctgtcacctcctggaagga
gagaagaccatcgactcggtgacgtccgcccaggagctccgaggctgcaccgtcatcaat
gggagccttatcatcaacattcgagggggcaacaatctggcagctgagctagaggccaac
ctcggcctcattgaagaaatttcagggtatctgaaaatccgccgttcctacgccctcgtg
tctcttgccttcttccggaagctacgtctgattcggggggataccttggaagtcgggaac
tactctttctatgccttggacaaccagaacctgaggcagctgtgggactggagcaaacac
cacctcaccatcactcaggggaaactcttcttccactataatcccaagctctgcttgtcg
gaaattcacaaaatggaggaagtttcaggaaccaaggggcgccaggagaggaacgacatc
gccctgaagaccaatggggaccaggcatcctgtgaaaatgaattacttaaattttctaac
attcggacgtcttttgacaagatcttgctgaaatgggagccgtactggccccccgacttc
cgagacctcctaggcttcatgctgttctacaaagaggccccttatcagaatgtgacagag
ttcgatgggcaggatgcatgtggctccaacagctggacggtggtggacattgacccacct
ttgaggtccaacgaccctaagtcacagagccaccccgggtggctgatgcggggtctgaag
ccctggacccagtatgccatcttcgtcaagaccttggtcaccttttctgatgaacgtcgc
acatatggggccaagagtgacatcatctatgtccagacagatgccaccaatccttctgtc
cccctggaccccatctcggtttccaactcctcatcccagatcatcctgaagtggaagcct
ccttctgaccccaacggcaacatcactcactacctggttttctgggagaggcaggcagag
gacagtgagctgtatgagctggattattgcctcaaagggctgaagctgccctcccggacc
tggtctccgccgtcggagtcggagggttcccagaagcacaaccagagtgagtacgatgat
gccgccggcgaatgctgctcctgccccaagaccgactctcagatcctgaaggagctagag
gagtcgtcgttccggaagacattcgaggactacctgcacaatgtggtttttgtccccagg
ccatcgaggaagcgcagggcccttggcgacgtggagaatgtgacgacggtcgcacccacg
gccccgagttttcccaacacctcctggaccagtgtgcccacgagcttggaggagcaccgg
cccttcgagaaagtggtgaacaaagagtcgctggtcatctccggcctgcgccacttcacc
ggctatcgcatcgagctgcaggcttgcaaccaggatgcgcccgaggaaaggtgcagtgtg
gcagcctacgtcagcgccaggaccatgccggaagccaaggcagatgacatcgttggcccc
gtgacccacgaaatcttcgagaacaacgttgttcacttgatgtggcaggagccgaaggaa
cccaacggtctgattgtgctgtatgaagtgagctatcgacgatacggcgatgaggagctg
cacctctgtgtctcccgcaggcatttcgctctggagcggggctgcaggctgcgtgggctg
cccccggggaattacagcgtgcgagtgcgggccacctccctggcaggcaatggctcctgg
acggaagccacctatttctacgtgacagactaccacgtcccatcaaatattgcaaaaatt
atcatcggtcccctcatctttgtcttcctcttcagcgttgtgatcggaagcatttatctg
ttcctgaggaagaggcagccagatgggcccctgggaccgctgtatgcttcttcaaaccct
gagtacctcagtgccagtgatgtgttcccctgttctgtgtatgtgccggacgagtgggag
gtgcctcgggagaagatcaccctcctgcgagagctggggcagggctccttcggcatggtg
tatgagggcaacgccaaggacatcatcaagggtgaggcagagacccgggtggcggtgaag
acggtcaacgagtcggccagcctgcgtgagcgcatcgagtttctcaacgaggcctcggtc
atgaagggcttcacctgccatcacgtggtccgcctcctgggggtggtgtccaaggggcag
ccgacactggtggtgatggagctgatggcccatggagacctgaagagctaccttcgttcc
ctgcggcctgaggctgagaacaaccctggccgccctcccccgaccctgcaagagatgatc
cagatggcggcggagatcgcggacgggatggcgtacctgaacgccaagaagttcgtgcac
cgggacctcgcagctcgaaactgcatggttgcccatgatttcaccgtcaaaatcggagac
tttggaatgaccagagacatctacgagacggattactaccggaaagggggcaagggcctg
ctccccgtgcggtggatggcgccggaatccctgaaggatggggtcttcactgcttcttca
gacatgtggtccttcggcgtggtcctctgggaaatcaccagcttggcagaacagccttac
caaggcctgtctaatgagcaggtgttgaaatttgtcatggatggagggtatctggatcaa
cccgacaattgtccagagagactcaccgagctgatgcgcatgtgctggcagttcaacccc
aagatgcggccgaccttcctggagatcgtcgacctgctcaaggacgacctgcaccccagc
tttccggaagtttccttcttccacagtgaggagaacaaggcgcccgagagcgaggagttg
gagatggagtttgaggacatggagagcgtccccctggaccggtcctcacactctcagagg
gaagaggacggagggtccacgctgggcctgaagcggaattacgaggatcacgtcccctac
acccacatgaacgggggcaagaaaaacgggcgggtcctgactctgccacggtctagtcct
tcctaa

DBGET integrated database retrieval system