KEGG   Pteropus alecto (black flying fox): 102881296
Entry
102881296         CDS       T02993                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:pale00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102881296 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pale04040]
    102881296 (ASIC1)
Ion channels [BR:pale04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   102881296 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 102881296
NCBI-ProteinID: XP_006916853
Position
Unknown
AA seq 559 aa
MPIQIFCSVSFSSGKEAPGPLGDVWGPHQRQQRDNSESEEEEEEKEKEAARKEVREGDLP
MDLVAFANSCTLHGASHVFVEGGPGLRQALWAVAFVLALGAFLCQVGDRVAYYLSYPHVT
LLDEVATTELAFPAVTLCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEAF
SGEPFNLHRFYNRSCHRLEDMLLYCSYRGGPCGPHNFSVVFTRYGKCYTFNSGRDGRPRL
KTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAP
GFQTFVACQEQRLIYLPPPWGTCKAVTMDSDFFDSYSITACRIDCETRYLVENCNCRMVH
MPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKY
LAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILT
VLELFDYAYEVIKHKLCRRGKCQKDAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTY
AANILPHHPARGTFEDFTC
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgcccatccagatcttctgttctgtgtcattctcctctggaaaggaggcccccgggccc
ttgggagatgtttggggtccccatcagcggcagcagcgagacaactcagaatcagaagag
gaggaagaagaaaaggaaaaggaggcagcgaggaaggaggtcagagagggagatttgccc
atggacttggtggcctttgccaacagctgcactctccatggcgccagccacgtcttcgtg
gaggggggtccagggctgaggcaggccctgtgggcagtggcctttgtcctggcactgggt
gccttcctgtgccaggtaggagaccgcgttgcctattacctcagctacccacatgtgact
ctgctagatgaggtggccaccacagagctggccttcccagcggtcaccctctgcaacacc
aatgctgtgcggctgtcccagctcagctaccccgacttgctctacctggcccccatgctc
gggctggacgaaagtgatgacccaggggtgcccctcgccccccctgggcctgaggccttc
tctggagagccctttaacctgcaccgtttctacaatcgctcctgccaccggctggaggac
atgctgctctactgttcctaccgcggggggccctgcggtcctcacaacttctcagtggtc
tttacacggtatggaaagtgctacacgttcaactcgggccgagatgggcgtccacggctg
aagaccatgaagggtgggacgggcaatgggctggagatcatgctagacatccagcaggac
gagtacctgcccgtatggggggagactgatgagacgtccttcgaagcaggcatcaaagtg
cagatccacagtcaggatgaacctcccttcatcgaccagctgggctttggtgtggcccca
gggttccagacctttgtggcctgccaggagcagcggctcatctacctgcctccaccctgg
ggcacctgcaaagctgttaccatggactcggatttcttcgactcctacagcattactgcc
tgccgcattgactgtgagacccgctacctagtggaaaactgtaattgccgcatggtgcac
atgccaggagatgccccatactgcactccagagcagtacaaggagtgtgcagatcctgct
ctggacttcctggtggagaaagaccaggagtactgtgtgtgtgaaatgccctgcaatctg
acccgctatggcaaggagctgtccatggtgaagatccccagcaaagcatcagccaagtac
ctggccaagaaattcaacaagtctgagcagtacataggggagaacatcctggtactggac
attttctttgaagtcctcaactatgagaccattgagcagaagaaggcttatgagattgca
ggtctcctgggtgacattgggggccagatggggctgttcatcggggctagcatccttacg
gtgctggagctctttgactacgcctatgaggtcattaagcacaagctgtgcagaagagga
aagtgccagaaggacgccaaaaggagcagcgcagacaagggtgtggccctcagcctggat
gacgtcaaaagacacaacccgtgtgagagcctccggggccatcctgccgggatgacgtat
gctgccaacatcctacctcaccatccggcccgaggcacttttgaggactttacctgctaa

DBGET integrated database retrieval system