KEGG   Pteropus alecto (black flying fox): 102881321Help
Entry
102881321         CDS       T02993                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: guanylate cyclase 2G-like
  KO
K22600  guanylate cyclase 2G [EC:4.6.1.2]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00230  Purine metabolism
pale01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102881321
Enzymes [BR:pale01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     102881321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr ANF_receptor Pkinase
Motif
Other DBs
NCBI-GeneID: 102881321
NCBI-ProteinID: XP_006921006
Position
Unknown
AA seq 851 aa AA seqDB search
MAPRTGAETPLRCRLCLGAKSHDAHPILVLTLFASVLVTWLEAAKHTVGFQAPWNISHPL
SMQRLGAGLQIAMDEINSELADLGNFSWGFTYTNSACSAKESLAIFTNQVQRERISAPFG
PACPEAAEVIGLLASEWNIPMFDFVGQTAKWESDFLDDXCVKLVPPMHVTGDVLQKSLWY
LGWKHIGMFGGHCRTSSLDRVDELWRVVENRLKSHFTITARVRYTNDDPALLQEDLRILS
AIARGVTGPVLVDSQGERRMDYSVCALQKSGNGSLFLPVLHYRSYQKAIRPVRNFSTITW
PHSSLPEGRPGCGFYNELCEAQPTFIGQLSVHVTAVILTTTLLITALGAAIIGLILKMQK
GKLLRQNKDVWWQIRYDDITILPQNKPSXRGTPVSRGNSSGSCSMMIPGDFSSFVKSQQG
EELFYALIGLYQGNHVAICCVGDQAEAWIRKPSVLQEIWLVYELRYENIVPFFGICTKPP
NTCIITQYCKKGSLKDVLRNSDNELDWIFKFSLAYDIVNGMLFLHRSLLGSHGNLNPSAC
LADGRMQVKLSGFALWELEYGQTYRIYNEKTVDCSGIVSXIRDSLASVPLGPSLSEEKGN
EKIAVLVRACRDEPPGKRPTFPSIKKILREASPKGHVNILDSMVSELEVYANRLEEVVEE
RTNQLMAEKRKVDKLLSTILLSFIGEQLIAGRSVEPEYFESVTIFFSDIVGFTKLCSLGS
PLQVVXNDLYSLFDHIIKTYDVYKVETIGDAYMVASGLPIHSGTKHVDEIATMSLHFLSA
AVHFQTGHMPEEKLKLRNGFHTGPVVAGMVGITMPRYCLFRDTVNMASRMESGTLRGYHL
RQFTNTISLSL
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaggacaggtgctgagaccccacttagatgtagactctgtttgggggctaaa
agccatgatgcccacccaatactagttttgacactctttgccagtgtgctggtgacttgg
cttgaagctgctaaacacactgtaggtttccaggctccctggaacatctcccatccactc
agcatgcaaaggctgggtgcaggcctccagattgccatggacgagatcaactcagagctg
gcagaccttggaaacttcagctggggcttcacttacaccaactcagcctgcagcgccaag
gagtctcttgctattttcactaatcaggtccagagagaaaggatttctgccccgtttgga
ccagcatgcccagaagcagcagaggttattggtttgctggcctctgagtggaatatcccc
atgtttgactttgttggacaaacagcaaaatgggagagtgacttcttggatgacncctgt
gtgaaacttgtgccacccatgcatgtaactggtgatgtgctccagaaaagtctctggtac
ctgggctggaaacacatcgggatgtttggaggtcactgcaggacttcctccttggatagg
gtggatgaattgtggcgggttgtagagaatagactcaaatcccatttcaccatcacagcc
agggtgagatacaccaatgatgacccagcccttctgcaagaggatcttaggatcctgtca
gcgattgccaggggagtcaccggtcccgtgttggtggattcccagggagaaaggcgtatg
gattactcagtctgtgccctgcagaaatccggaaacgggtctctctttcttcctgttctt
cactatcgcagctatcagaaagcgatcagacctgtgaggaatttctccactatcacttgg
ccccacagctcacttcctgaaggcagacctggctgtggattttacaatgagctctgtgaa
gctcagcctacttttataggtcagctctcagtgcatgtgactgctgtgattctcaccacc
accctcctgattactgccttgggagctgccatcataggtctgattttaaagatgcagaag
ggaaaactgctgaggcaaaataaagacgtttggtggcaaatccgttatgacgacatcact
attctgcctcaaaacaagccatcctagagaggcacacctgtatcaagagggaacagcagt
ggctcatgtagcatgatgattcctggggacttcagctcctttgtcaagagccagcagggg
gaagagctcttttatgccctgatagggctttaccagggaaaccatgtggccatctgctgt
gttggtgaccaagcagaagcctggatcaggaagccatctgtgctgcaggaaatctggctg
gtgtatgaattaaggtatgaaaacattgttcccttctttggtatttgcacaaaaccaccc
aacacctgcatcatcacccagtattgcaaaaaaggaagtcttaaggatgttttgagaaac
tcagataatgaattggattggatattcaaattctcattggcgtatgacatagtcaatggc
atgctgttcctccacaggagcctgctggggtcccatggcaacctgaacccttccgcctgc
ctggcggatggccggatgcaggtgaagctgtcggggtttgcgctgtgggaactcgagtat
ggccagacatacagaatatataatgagaaaacagtggactgctcaggaatcgtcagctga
atcagagactccttggcctctgttccacttggaccttccctgtcagaggagaagggcaat
gaaaagatcgcggttctggtgagggcatgtcgggatgaacctccagggaaaaggcccacg
ttcccttccatcaagaagattttacgagaagccagtcccaaaggccacgtgaacatacta
gacagtatggtgagcgagctggaggtgtacgccaatcgcctggaggaggtggtggaagag
aggaccaaccagctgatggcagagaagaggaaagtcgataagcttctctccacaatactt
ctcagcttcattggagaacagctcatagctggaaggtctgtggaaccagaatattttgag
tctgtgaccatctttttctctgacattgttggattcacaaaactctgttctctcggctcc
cccttgcaagtcgtannaaatgacctgtacagtttattcgatcacatcattaaaacatat
gatgtgtataaggtcgaaaccattggggatgcatacatggtagccagcggacttcccatc
cacagtggaaccaagcatgtggacgagattgccacgatgtccttgcatttcctcagtgcc
gccgtccacttccagactgggcacatgcctgaggagaagctcaagcttcggaatggcttc
cacacaggtcccgtggtggccggcatggtgggaatcaccatgcccagatactgtctgttc
agagacactgtgaacatggcatccagaatggaaagcggcactttgcgtgggtatcactta
cggcagtttacaaacacaatatcgctgtccctctag

DBGET integrated database retrieval system