KEGG   Pteropus alecto (black flying fox): 102881510Help
Entry
102881510         CDS       T02993                                 

Gene name
DOCK6
Definition
(RefSeq) dedicator of cytokinesis protein 6
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
pale  Pteropus alecto (black flying fox)
Brite
KEGG Orthology (KO) [BR:pale00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102881510 (DOCK6)
Membrane trafficking [BR:pale04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    102881510 (DOCK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 102881510
NCBI-ProteinID: XP_024895790
Position
Unknown
AA seq 2135 aa AA seqDB search
MSKMFNLPASRSVRTHPLLAISSGLPLPSLVIICLNRTVAAEVRKQVSRERSGSPHSSRR
CSGSLGVPLTEVIEPLDFEDVLLSRPPDAEPGPLRDLVEFPADDLELLLQPRECRTTEPG
IPEDEKLDAKVRAAVEMYTEDWIIAHRRYQHLSAAYSPITTETQRERQKGLTRQVFEQDA
SGDEKSGLEDSDDPRHSSGSPEDTPRSSGASGIFDLRNLAADSLLPSLLERTAPEDVDRR
NEVLRRQHRPRALLALYPAPDEDEAVERCIHPEPPREHFGQRILVKCLSLKFEIEIEPIF
GILALYDVREKKKISENFYFDLNSDSMKGLLRAHGTHPAISTLARSAIFSVTYPSPDIFL
VIKLEKVLQQGDISECCEPYMVMKEVDTAKNKEKLEKLRLAAEQFCTRLGRYRMPFAWTA
VHLANIVSSAGQPDRDSDSEGERRSAWTDRRRRGPPDRTSSGDDACSFSGFRPATLTVTN
FFKQEAERLSDEDLFKFLADMRRPSSLLRRLRPVTAQLKIDISPAPENPHFCLSPELLHV
KPYPDPRGRPTKEILEFPAREVYAPHTSYRNLLYVHPHSLNFSSRQGSVRNLTVRVQYMA
GEDPSQALPVIFGKSSCSEFAQDAFTPVVYHSKSPEFYEEFKLRLPACMTENHHLLFTFY
HVSCQPRPGTALETPVGFTWIPLLQHGRLRTGPFCLPVSVDQPPPSYSVLTPDVALPGMR
WVDGHKGVFSVELTAVSSVHPQDPHLDKFFTLVHVLEEGAFPFRLKDGVLSEGTVEQELR
ASLAALRLASPEPLVAFSHHVLDKLVRLVVRPPIIGGQIVNLGRGAFEAMAHVVSLVHRS
LEPAQDARGHCPLLAAYVYYAFRLPGTEPSLPGGAPPVTVQPATLARGPGRPASLYLARS
KSISSSNPDLAVAPGSVDDEVSRILASKGIDRSHSWVNSAYAPGGSKAVLRRAPPYCGAD
PRQAIDRSSSRTSSYLESSSSAPPATQPRPTVQKLLHEELALQWVVSGSTVREAVLQHAW
FFFQLMVKSMALHLILGQRLDTPRKLRFPGRFLDDIAALVGSVGLEVITRVHKDAELAER
LNASLAFFLSDLLSLVDRGFVFSLVRAHYKQVATRLQSAPNPAVLLTLRMDFTRILCSHE
HYVTLNLPCCPLSPPASPSPSVSSTTSQSSTFSSQAPDPKVTSMFELSGPFRQQHFLAGL
LLTELALALEPEAEGASLLHKKAISAVHSLLCGHDADPRYAEATVKAHVAELYLPLLSLA
RDTLPRLHDFAEGPGQRSRLALMLDSDTEGEGDTGGTINPSVAMAIAGGPLAPGSRASIS
QGGATGSRSGCPLSAESSRTLLVCVLWVLKNAEPALLQHWAADLSLPQLGRLLDLLYLCL
AAFEYKGKKAFERINSLTFKKSLDMKARLEEAILGTIGARQEMVRRSRERSPFGNQENVR
WRKSITHWRQTSDRVDKTKDEIEHEALVDGNLATEASLVVLDTLEIIVQTVMLSEARESV
LGAVLKVVLYSLGSAQSALFLQHGLATQRALVSKFPELLFEEDTELCADLCLRLLRHCGS
RIAAIRTHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTTQNFSEEHLRRSLKTI
LTYAEEDVGLRDTTFAEQVQDLMFNLHMILTDTVKMKEHQEDPEMLIDLMYRIARGYQGS
PDLRLTWLQNMAGKHGELGNHAEAAQCMVHAAALVAEYLALLEDSRHLPVGCVSFQNISS
NVLEESAISDDILSPDEEGFCSGKHFTELGLVGLLEQAAAYFTMGGLYEAVNEVYKTLIP
ILEAHRDYKKLAAVHGKLQEAFTKIMHQSSGWERVFGTYFRVGFYGARFGDLDEQEFVYK
EPSITKLAEISHRLEEFYTERFGEDVVEIVKDSNPVDKTKLDPQKAYIQITYVEPHFDTY
ELKDRVTYFDRNYGLRTFLFCTPFTPDGRAHGELHEQHKRKTLLSTDHAFPYIKTRIHVC
HREETVLTPVEVAIEDMQKKTRELAFATEQDPPDAKMLQMVLQGSVGPTVNQGPLEVAQV
FLAEIPEDPKLFRHHNKLRLCFKDFCKKCEDALRKNKALIGPDQKEYHRELERNYGRLRE
ALQPLLTQRLPQLLAPSTAGLRNSLNRASFRKAEL
NT seq 6408 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatgttcaacttgccagcaagtcgatctgtaagaacccacccacttctggcc
atctcctcaggcctacccctgcccagcctggtcatcatctgcctgaatcggacagtggct
gccgaggtgcggaagcaggtgtcgcgggagcgcagtggctctccccactccagcaggcgc
tgcagcggctccctgggggtcccactgactgaagtcattgagcccctggactttgaggac
gtgctactgagccggccaccagatgctgagcctgggcccctccgagacctggtcgagttt
ccagctgatgacctggagctgctgctgcagccccgggagtgccggaccacagagcccggg
atccccgaggatgaaaagctggacgccaaggtgagggccgcggtggagatgtacacagag
gactggatcatcgcccatagaaggtaccagcatcttagcgcagcgtacagtcccatcacc
acagagacccagcgagagcggcagaagggcctcacccgccaggtctttgagcaggacgct
tctggggatgagaagtctggcctggaggactcggatgacccccggcactcctctggctcc
cctgaggacactccacgaagcagcggcgcctctggcatcttcgacctgaggaacttagca
gccgactcactgttgccctccctgctggagcgcacggcgcccgaggacgtggaccggcgc
aatgaggttctgcgccggcagcaccgtccccgcgccctgcttgccctctacccggcgccg
gatgaggatgaggctgtggaacgctgcatccacccggagccacctcgtgaacattttgga
cagaggatcctggtcaagtgtctgtcacttaagttcgagatcgagatcgagcccatcttt
ggcatcttggccctgtatgatgtacgggagaaaaagaagatctcagagaacttctacttt
gacctgaactcggactccatgaaggggctgctgcgggcccatggtacccacccagccatc
tctaccctggcccgctctgccatcttctccgtgacctacccctcacctgacatcttcctg
gtcatcaagctggaaaaggtgctacagcagggggacatcagcgagtgctgtgagccttac
atggtgatgaaggaggtggacacagccaagaacaaagaaaagctggagaagctgcgcttg
gcagccgagcagttctgcacccgcctgggccgctaccgcatgcccttcgcctggaccgca
gtgcacttggccaacatcgtgagcagcgcggggcagccggaccgtgactcagactcagag
ggcgagcgccgatccgcctggactgaccgccgccgtcgggggcccccggaccggacgagt
agtggggacgatgcctgtagcttctctggcttccgcccagccacattaactgtcaccaac
ttctttaagcaggaagcagagcggctcagcgatgaggacctcttcaagttcctggctgac
atgcggcgcccgtcatccttgctgcggcgactacggcctgtgactgcccagctgaagatc
gacatctccccggcccccgagaaccctcacttctgcctgtccccggagctgcttcatgtc
aagccctacccagaccccagaggccggcccactaaggagattctggagttccctgcccgt
gaggtctacgctccccacaccagctacaggaacctgctctacgtgcacccgcacagcctc
aacttcagcagccgccagggctctgtgcgaaacctcaccgtgcgagtgcagtacatggcg
ggcgaggaccccagccaggccttgccggtcatctttggtaagtccagctgcagcgaattc
gcccaggatgccttcacgcctgtggtctaccacagcaaatcccctgagttctatgaggag
ttcaagctgcgtcttccggcctgcatgactgagaaccaccacctgctcttcaccttctac
cacgtcagctgccagccgcggcctggcactgccctggagactcctgtgggctttacttgg
atcccactgctgcagcacggccgcctgaggacgggccccttctgcctgcctgtgtccgtg
gaccagcccccacccagctactccgtgctcacacctgatgtggcacttccgggcatgcgc
tgggtggatggccataagggcgtattcagcgtggagctcacagctgtgtcctctgtgcac
ccccaggacccacacctggacaagttcttcaccctggtgcatgtcttggaggagggggct
ttcccgttccggctcaaggatggcgtgctgagcgagggcaccgtggagcaggagctgcgg
gccagcttggctgccctgcgccttgccagccccgagcccctcgtagccttttcccaccac
gtgctggacaagctcgtacgtctggttgtacggcccccgatcatcggcggccagattgtg
aacctgggtcgtggagcctttgaagcaatggcccatgtagtcagcctcgtccatcggagc
ttagagcctgctcaggatgcccgtggtcactgcccactcctggctgcctatgtgtactat
gccttccgattgcctggcactgagcccagcctcccaggtggggcacctccagtgacagtg
cagcctgccacgctggcccgtgggcccggccgccctgcaagcctctacctggctcgctct
aagagcatcagcagcagcaaccccgacctggccgtggcccctggctctgtggatgatgag
gtctcccgcatcctggccagcaagggtattgaccgttcacactcctgggtgaattctgcc
tatgctccaggaggcagcaaggctgtgctgagacgggcacccccttattgtggggccgac
cccagacaggccatcgaccgcagctctagccgaacctcttcctacctcgagagctcctcc
tcggccccaccagccacccagccgagacccactgtgcagaagctgcttcacgaggagctg
gctttgcagtgggtggtcagtggcagcaccgtgcgtgaggccgtcctgcagcacgcctgg
ttcttcttccaactgatggtgaaaagcatggcgttgcacctgattctgggccagcggctg
gacacgccccgcaagctacgcttccctgggcgcttcctggatgacatagcagctctggtg
ggctctgtgggcctggaagtcatcacccgggtacacaaggatgcggagctggccgagcgc
ctcaatgccagcctggccttcttcctcagtgacctgctgtccctggtggaccgcggcttc
gtcttcagcctggtccgggcccactacaagcaggtggccacacggctgcagtcggccccc
aacccagcggtgctgctgaccctgagaatggatttcacccgcatcctgtgcagccacgag
cactacgtgaccctcaacctcccctgttgtcccctgtcgcccccagcctcaccctcaccc
tccgtatcctccaccacctcccagagctccaccttctccagccaggccccagaccccaag
gtgaccagcatgtttgagctgagcgggccgttccggcagcagcacttcctggctgggctc
ctgctgacggaactggcgctggccctggaacctgaggctgagggggcatccctgctgcac
aagaaagccatcagtgctgtccacagcctgctctgtggccacgatgctgacccccgctac
gccgaggccaccgtgaaggcccacgtggctgagctgtacctaccactgctgtcgctcgcc
cgggacacactgccacggctacatgactttgctgagggtccaggtcaacggtcaagactg
gccttgatgctcgactcagacacagaaggggaaggggacactggaggcaccatcaacccc
tcagtggccatggccatcgctggtggccccctggcccctggctcccgagccagcatctcc
cagggcggagcgacaggttctcgctcaggctgtcccctctctgccgagtccagtcggacc
ctgctggtatgtgtgctgtgggtactgaagaatgcagagccagccctcctgcagcactgg
gctgccgacctgtctctccctcagctgggtcgtctcttggacttgctgtatctctgcctg
gccgccttcgagtacaaggggaaaaaggcctttgagcgcatcaacagcctcacgttcaag
aagtcactggacatgaaagctcgactggaagaagccattttgggcaccatcggagcacga
caggagatggtgcggcggagccgtgaaaggagcccgtttgggaaccaggagaacgtgcgc
tggcggaagagcatcacgcactggagacaaacctcagaccgtgtggacaagaccaaggat
gaaatagaacatgaggccttggtggacgggaacctggcaactgaggcgagcctggtggtt
ctggacacactggagatcatcgtgcagacggtgatgctgtcggaggcccgggagagcgtc
ctgggcgcggtgctcaaggtcgtgttgtacagtctgggcagtgcccagagtgccctcttc
ttgcagcatggcctggccacacagcgggccctggtgtccaagttcccagagctgctattc
gaagaggacacggagctctgtgctgacctctgcctgaggctcctgcgacactgcggcagc
cgcatcgccgccatccgcacgcacgccagcgcctcgctctacctcctcatgcgccagaat
ttcgagatcggcaacaactttgcccgcgtgaagatgcaagtgaccatgtcactgtcgtcc
ttggtggggacaacgcagaacttcagtgaagagcacctgcgacggtcgctcaagaccatc
ctcacctatgccgaggaggacgtggggctgcgggacaccacttttgcggagcaggtccag
gacctgatgttcaacctgcatatgatcctgacggacacggtgaagatgaaagagcatcag
gaagaccccgagatgctcattgacctcatgtacaggattgcccggggttaccagggctcc
ccggacctgcggctgacgtggctgcagaacatggcagggaagcatggagagctgggcaac
catgcagaggccgcacagtgcatggtgcacgcggctgccctggtggccgagtacctcgcc
ctgctcgaggacagccgccacctgcctgtgggctgcgtttccttccagaatatctcgtcc
aatgtgctggaggagtccgccatctctgatgacatcctgtcgcctgacgaggagggcttc
tgctctgggaagcacttcacagagctgggtctggtggggctgctggagcaggctgctgcc
tacttcaccatgggcgggctctatgaggcagtgaacgaggtgtacaagaccttgatcccc
atcctggaagcccaccgggactacaagaagctggctgctgtgcacggcaaactgcaggaa
gccttcaccaagatcatgcaccagagctctggctgggagcgcgtttttggaacatacttc
cgtgtgggtttctatggcgcccgcttcggtgacctggatgagcaggagtttgtgtacaag
gagccatccatcacgaagctggcagagatctcccaccggctggaggagttctacacggag
agatttggggaggatgtagtcgagattgtcaaagattcaaaccctgtggacaagaccaag
ctcgacccccagaaggcctacatccagatcacgtatgtggaaccgcattttgacacctat
gagcttaaggaccgggtgacctatttcgatcgcaactacgggctgcgcacctttctgttc
tgcacgcccttcacacccgacgggcgtgcacacggggagctgcatgaacagcacaagcgc
aagacactgctgagcacggaccacgccttcccttacatcaagactcgcatccacgtgtgc
catcgggaggagacagtgttgacaccagtggaggtggccatcgaagatatgcagaagaag
acacgggagctggcctttgccaccgagcaggacccgcctgatgccaagatgctgcagatg
gtgctacaaggctctgttgggcccactgtgaaccagggtcccctagaggtggcccaagta
tttttggcagagatcccagaagatcccaagctcttcaggcatcacaacaagctgcgactc
tgttttaaggacttctgcaaaaagtgtgaggatgcactgaggaagaacaaggctctgatt
gggccggaccagaaggagtaccaccgtgagctggagcgcaattacggccgcctgcgggag
gctctgcagcccctgctcacccagcgcctgccccagctgctagcaccatccactgccggc
ctcaggaactctttgaacagagcgagcttccggaaggctgaactctga

DBGET integrated database retrieval system