KEGG   Pteropus alecto (black flying fox): 102882782Help
Entry
102882782         CDS       T02993                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00010  Glycolysis / Gluconeogenesis
pale00562  Inositol phosphate metabolism
pale01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102882782 (MINPP1)
   00562 Inositol phosphate metabolism
    102882782 (MINPP1)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     102882782 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     102882782 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 SID DUF4708
Motif
Other DBs
NCBI-GeneID: 102882782
NCBI-ProteinID: XP_006926043
UniProt: L5JNG6
Position
Unknown
AA seq 487 aa AA seqDB search
MLRGPGYFLWVPVPPAAALAVALLSSLSHCSFLEPADPVISSLSPYFGTKTRYEDANCGL
LRDPEVPRRDPELLEDTCTPLQLVALIRHGTRYPTAKQIRKLRQLHGLLQARRPRDDRAD
AVGGRDLGAALANWPLWYADWMDGQLVEKGREDMRQLALRLASLFPALFSHENYSRLQLV
TSSKHRCVESGVAFLKGLWQHYHPGLPPPDVADMECNPPRINDKLMRFFDHCEKFLTEVE
GNDTALYHVEAFKTGPEMQNILKKVAAALQVPFNSLNADLIQVAFFTCSFDLAIKGVKSP
WCDVFDTDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKKRSQPV
SSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQMHRKFRSGHIVPYASNLIFVLY
HCKNAKTLKEEFRVQILLNEKVLPLAHSQETVSLYEDLKNHYKDILQSCNTGEECKLPKV
NNTSDEL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcggacccggctactttctctgggttcccgtgccacccgcagcggccctggct
gtggctctgctgtcgtcgctttcgcactgctccttcctggagccggcggaccctgtgatt
tcgtcgctcagcccatacttcggcaccaagacgcgctacgaagatgcgaactgtgggctg
ctgcgggaccccgaggtgccgcggcgggacccggagctgctggaggacacctgcacccca
ttgcagcttgtcgccctcatccgccacggcacccgctatcctacggccaaacagatccgc
aagctgcggcagttacacggactgctgcaggcccgcaggcccagggatgacagggccgac
gccgtcggcggccgagacctaggcgctgcgctggccaactggccgctgtggtacgcggac
tggatggacgggcagctggtggagaaggggcgggaggacatgcgacagctggcgctgcgc
ctggcctcccttttcccggccctcttcagccacgagaactacagccgcctgcagctcgtc
accagctccaagcaccgctgcgtggagagcggcgtcgccttcctgaaggggctgtggcag
cactatcaccctgggttgccgccgcccgacgtcgcagatatggagtgcaaccctccaaga
attaatgataaactaatgaggttcttcgatcattgtgagaagtttttaaccgaagtggaa
gggaatgatacagctctttatcatgtagaagccttcaaaactggaccagaaatgcagaac
attttgaaaaaagttgcagctgctttgcaagtgccattcaacagtttaaatgcagattta
attcaggtagctttttttacctgttcatttgacctggcaattaaaggtgttaaatctcct
tggtgtgatgtctttgacacagatgatgcaaaggtattagaatatttaaatgatctaaaa
caatattggaaaagaggatatgggtatacgatcaatagtcgatccagctgcaccttattt
caggatatctttcagcatttggacaaagcagttgaacagaaaaaaaggtctcagccagtt
tcctctccagtcattcttcaatttggtcatgcagagacccttcttccactgctttctctc
atgggctacttcaaagacaaggagcccttaacagcttacaattacaaggaacaaatgcat
cggaagttccgaagtggtcacattgtaccctatgcctcaaacctaatatttgtgctttac
cattgtaaaaatgctaagactcttaaagaagaattccgagtgcagatattattgaatgaa
aaagtgttaccattggctcactcacaagaaaccgtttctttgtatgaagatctgaagaac
cactacaaggacatccttcagagttgtaataccggtgaagaatgtaaattaccaaaggtg
aacaacacatctgatgagctatga

DBGET integrated database retrieval system