KEGG   Pteropus alecto (black flying fox): 102882801Help
Entry
102882801         CDS       T02993                                 

Gene name
TSPAN12
Definition
(RefSeq) tetraspanin-12
  KO
K17355  tetraspanin-12
Organism
pale  Pteropus alecto (black flying fox)
Brite
KEGG Orthology (KO) [BR:pale00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    102882801 (TSPAN12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin
Motif
Other DBs
NCBI-GeneID: 102882801
NCBI-ProteinID: XP_006910637
Position
Unknown
AA seq 305 aa AA seqDB search
MAREDSVKCLRCLLYALNLLFWLMSISVLAVSAWMRDYLNNVLTLTAETRVEEAVILTYF
PVVHPVMIAVCCFLIIVGMLGYCGTVKRNLLLLAWYFGSLLVIFCVELACGVWTYEQEIM
VPVQWSDMITLKARMTNYGLPRYRWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWPPDS
CCVREFPGCSQQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQILAMIL
TITLLWALYYDRREPGTDQMMSLKNDTTQHLSCHSVELLKPSLSRIFEHTSMANSFNTHF
EMEEL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggccagagaagattccgtgaagtgccttcgctgcctgctgtacgccctcaatctgctg
ttttggttaatgtccatcagcgtgttggcagtttctgcttggatgagggactacctaaat
aatgttctgactttaaccgcagaaacaagggtagaggaggctgtcatcttgacttacttt
cctgtagttcatccggtcatgattgccgtttgctgtttcctgatcatcgtggggatgtta
ggatactgtggaacagtgaaaagaaatctgttgcttcttgcatggtactttggaagttta
cttgtcattttctgtgtagaactggcttgtggtgtttggacatatgaacaggaaattatg
gttccagttcagtggtcagacatgatcactttgaaagccagaatgacaaattatggctta
cctagataccgatggcttactcatgcttggaatttttttcagagagagttcaagtgctgt
ggagtggtttacttcaccgactggttggagatgacagagatggactggccaccagattcc
tgttgtgttagggaattcccgggatgttcccaacaggcccaccaggaggatctgagtgac
ctttatcaagagggttgtgggaagaaaatgtattcatttttgagaggaaccaaacaactg
caggtgctaaggtttctgggaatctccattggagtgacacaaatcctggccatgattctc
accataactctgctctgggctctctattatgatagaagggaacctgggacagaccaaatg
atgtccctgaagaatgatacaactcaacacctgtcatgtcactcagtagaactgttgaaa
ccaagcctgtcaaggatctttgaacatacttctatggcaaacagctttaatacacacttc
gagatggaggaattatag

DBGET integrated database retrieval system