KEGG   Pteropus alecto (black flying fox): 102884402
Entry
102884402         CDS       T02993                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04080  Neuroactive ligand-receptor interaction
pale04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102884402 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102884402 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 102884402
NCBI-ProteinID: XP_006911828
Position
Unknown
AA seq 77 aa
MNLRLCVQALLMLWLSLIAVSGGPLMQPSAGKGLKEGTIHHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggctgtgtgtgcaggcgctcctgatgctctggctctccctgatcgccgta
tctggagggcccctgatgcagccttctgccgggaaggggctaaaagaaggcactatccac
cacctggtgcaacccagagggtcaaggaatggaccagggccctggcagggaggtcggaga
aaattccgccgccagcggccacgtctctcccataagggccccatgcctttctga

DBGET integrated database retrieval system