KEGG   Pteropus alecto (black flying fox): 102884464Help
Entry
102884464         CDS       T02993                                 

Definition
(RefSeq) alcohol dehydrogenase class 4 mu/sigma chain-like
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00010  Glycolysis / Gluconeogenesis
pale00071  Fatty acid degradation
pale00350  Tyrosine metabolism
pale00830  Retinol metabolism
pale00980  Metabolism of xenobiotics by cytochrome P450
pale00982  Drug metabolism - cytochrome P450
pale01100  Metabolic pathways
pale05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102884464
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102884464
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102884464
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102884464
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102884464
   00982 Drug metabolism - cytochrome P450
    102884464
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102884464
Enzymes [BR:pale01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     102884464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N
Motif
Other DBs
NCBI-GeneID: 102884464
NCBI-ProteinID: XP_006925352
Position
Unknown
AA seq 148 aa AA seqDB search
ILATGICRSDDHVMKGTLASKFPVIVGHEAVGVVESIGEGVTTVKPGDKVIPLFVPQCRE
CKSCRNPDANVCIMSDFTGRGVLADGTTRFTCRGKTVYHFVNTSTFTEYTVVDEFAVVKI
DDAAPPEKVCLLGCAFSTGYGAAVKTGK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
attttggccacaggaatctgtcgctcagatgaccatgtgatgaaaggaacgttagcatct
aagtttccagtgattgtgggacatgaagcagttggggtcgtggagagcatcggagaagga
gtcactacggtgaaaccaggtgacaaagtcatccccctctttgtgcctcagtgtagagaa
tgcaaatcttgccgcaatccagatgcaaacgtttgcattatgagcgactttacgggccgc
ggagtactggccgatggcactaccagatttacatgcaggggcaaaaccgtctatcacttt
gtgaacaccagtacgtttactgagtacacggtggtggacgaatttgccgttgttaagatt
gatgatgcagctcctccagagaaagtctgtttacttggatgtgcgttttccacaggatat
ggggctgctgttaaaactggcaag

DBGET integrated database retrieval system