KEGG   Pteropus alecto (black flying fox): 102884551Help
Entry
102884551         CDS       T02993                                 

Gene name
MTMR4
Definition
(RefSeq) myotubularin-related protein 4 isoform X1
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00562  Inositol phosphate metabolism
pale01100  Metabolic pathways
pale04070  Phosphatidylinositol signaling system
pale04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102884551 (MTMR4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    102884551 (MTMR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102884551 (MTMR4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pale01009]
    102884551 (MTMR4)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     102884551 (MTMR4)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     102884551 (MTMR4)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     102884551 (MTMR4)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    102884551 (MTMR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 102884551
NCBI-ProteinID: XP_006924941
Position
Unknown
AA seq 1209 aa AA seqDB search
MSLTARVSCSMLSCFGEEGPPSLEYIQAKDLFPPKELVKEEENLQVPFTVLQGEGVEFLG
RAADALIAISNYRLHIKFKDSVINVPLRMIDSVESRDMFQLHIACKDSKVVRCHFSTFKQ
CQEWLSRLSRATARPAKPEDLFAFAYHAWCLGLTEEDQHTHLCQPGEHIRCRQEAELARM
GFDLQNVWRVSHINSNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHLRN
GAAIARCSQPEISWWGWRNADDEYLVTSIAKACALDPGTRATGGSLSTGNSDSSEACDTD
FDSSLTACSGVESTAAPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVVFMGMANI
HAIRNSFQYLRAVCSQMPDPSNWLSALESTKWLQHLSVMLKAAVLVANTVDREGRPVLVH
CSDGWDRTPQIVALAKILLDPYYRTLEGFQVLVESDWLDFGHKFGDRCGHQENAEDQNEQ
CPVFLQWLDSVHQLLKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPCEREKRNIYKR
TCSVWALLRAGNKNFHNFLYTPGSDMVLHPVCHVRALHLWTAVYLPASSPCTLGEENMDL
YLSPVAQSQEFSGRSLDRLPKTRSMDDLLSACDTSSPLTRTSSDPNLNNHCQEARVGLEP
WHSNPEGSETAFVESGVEGPQQTVGEMGLPPPLSSSQKDYLSNKPFKSHKSCSPSYKPLN
ATVPQEMKSHTSDPEIKVLEETKVPASDLPAQDELGRTLDGTEEPPEHFPEKAAVSVLSN
VISNKCDGICDFSESSQEPPTGAPKQAQLDSGLGVSSRSAPSHSLGTLCNPPSATCHTPP
DPTADFLNQDPPGSVASISHQEQPSSVPDLIHGEEDTGKRGNNRNGQLLENLRFGKVPLE
LARRPISQSQISEFSFIGSNWDSFQGMVTSFPSGETTPRRLLSYGCCSKRSNSKQMRATG
PCFGQWAQREGVKSPLCSSHSNGHCTGPGGKNNRIWVSSYPKQVSSTKPVPLSCPSPVPP
LYLDDDGLPFPTDVIQHRLRQIEAGYKQEVEQLRRQVRELQMRLDIRHCCAPPQEPPMDY
EDDFTCLKESDGSDTEDFGSDHSEDCLSEASWEPVDKKETEVTRWVPDHMASHCYNCDCE
FWLAKRRHHCRNCGNVFCAACCHLKLPIPDQQLYDPVLVCNSCYEHIQVSRARELMSQHL
KKPIATASS
NT seq 3630 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgaccgcccgcgtatcctgctccatgctcagctgctttggtgaggaggggccc
cccagcctggagtacatccaagccaaggacctgttcccccccaaggaactagtgaaagaa
gaggagaatctacaggtgcccttcacagtgctgcagggtgagggagtggagttcctgggc
agggcagccgatgccctcatcgccatctccaactaccgactgcatattaagttcaaggac
tccgtcatcaacgtccccctccggatgattgacagtgtggagagccgtgatatgttccag
ttgcacattgcctgcaaggactccaaagtggtgaggtgccacttctccactttcaagcag
tgccaagagtggctctcacggctaagccgggccacagcaagacctgccaagcctgaggac
ctctttgcctttgcctaccatgcctggtgcctggggctgaccgaggaagaccagcatacc
cacctgtgtcagccaggagagcacatacgatgtcgacaggaggctgaacttgcgaggatg
ggctttgacctgcagaatgtctggagagtctctcatatcaacagcaactacaaattgtgt
cccagttacccacagaagcttctggttcctgtgtggatcacagataaagagctggagaat
gtggcttccttccgctcctggaagcggatccccgtggttgtgtatagacacctacgcaat
ggggctgccatcgcccgctgcagtcagccagagatcagctggtggggctggcgcaatgct
gatgatgagtacttggttacatccatcgctaaagcttgtgccctggacccagggacaaga
gccactgggggctccctcagcactgggaatagtgattccagcgaggcatgtgacactgac
tttgattcttccctgactgcatgctctggagtggagagcacagcagcccctcagaagcta
ctgattctggatgctcgatcctacacagcagcagtggctaaccgggctaagggtggaggt
tgcgaatgcgaagagtactatcccaactgtgaggtcgtgttcatgggaatggccaacatc
catgctatcaggaacagcttccagtacctccgtgctgtgtgtagccagatgccagaccct
agcaactggttatcggcgctggagagcaccaaatggctgcagcacttgtcggtgatgcta
aaggcagctgtgctcgtggctaatacggtagatcgggaaggccggcctgtgctggtgcat
tgttcagacggctgggaccggacgccacagatcgtagccctggccaaaatactactggac
ccgtattacaggacattggagggcttccaagtattagtagagtctgactggctggatttt
gggcataaatttggagatcgctgtggccaccaagagaatgcagaggaccaaaatgagcaa
tgccctgtgttcctccagtggcttgattctgttcatcagctgctcaagcagttcccctgc
ctgttcgaatttaatgaagcattcctagtcaagctggtacagcacacgtactcctgcctc
tacggcacattcctggccaacaacccctgtgagcgagagaagcgcaacatctacaagcgg
acctgctctgtgtgggccctcctgcgagctggcaataagaactttcataacttcctctac
acacctggctcagacatggtcctgcatcctgtgtgtcatgtccgggccctgcacctctgg
actgctgtttacttgccagcatcgtctccatgcactcttggggaggagaacatggatctt
tatctttctccggtggctcagagccaggagttctctggccgttctctggacagattacct
aaaaccagatctatggatgatcttctttctgcctgtgatacaagcagccccctgacgcgc
acatccagtgaccccaacctgaataaccactgtcaggaggccagagtaggcctggaaccc
tggcatagcaatcctgagggatcagagacagccttcgtggaatctggggtagaaggtcct
cagcagactgtaggagaaatgggtcttcctccccctctatccagcagccagaaagactac
ttgagcaataaacctttcaagagtcacaaaagctgctctccaagctacaaaccgcttaat
gccacagtgccccaggaaatgaagagccacacctctgatcctgagatcaaagtcctggaa
gagactaaagtaccagcctcagaccttcctgcccaggatgagttgggtaggactttagat
ggcacagaggagccacctgaacattttcctgaaaaagcagctgtcagtgtgctctctaac
gttatttccaacaagtgtgatggaatttgtgatttttctgagtcttcccaggagcctccc
acaggtgcccccaagcaggcccagctagactctgggctaggtgtgtcctccagatctgct
ccaagtcacagtctgggcaccctttgcaacccaccaagtgctacctgccacactcctcca
gatccaactgctgactttctcaaccaagatcccccgggatctgtggcaagtatctcccac
caggaacagcccagttctgtaccagatctgattcatggagaggaagacactggcaaaaga
gggaataataggaacgggcagttactggaaaatcttcgctttgggaaagtgccgttggaa
ttggcacgaaggccaatttctcagagccagattagtgagttctcctttatagggtccaac
tgggacagcttccaggggatggtgacttcattcccaagtggggagaccacccctcggcgg
ctgctttcctatggttgttgtagcaagaggtcgaacagtaagcagatgcgggcaacgggg
ccctgctttggccagtgggctcagagagaaggggtgaagtcacctctttgttctagtcat
tccaatggacactgtactggcccaggaggaaaaaacaaccggatatgggtgtccagttac
ccaaagcaggtctccagcacaaagcctgttccactgagctgcccttctccagtgcctcct
ctctacctggatgatgatggactcccctttcctacggatgtgatccagcatagattacgg
caaattgaagcagggtacaagcaagaggtggagcagctacgtcgacaggtgcgtgagctg
cagatgaggctggatatccgtcactgctgtgcacctccacaagagcctcccatggactat
gaggatgattttacgtgtttgaaggagtcagatggcagtgatacagaagattttggctct
gatcacagtgaagactgcctttcagaagcaagctgggaacctgttgataagaaagagact
gaggtgactcgctgggttccagaccatatggcatcacattgctataactgtgactgtgaa
ttctggttggccaaacgaagacatcattgcagaaattgtgggaatgtattttgtgctgcc
tgctgccacctgaagttgcccattcctgatcaacaactctatgacccagttctcgtctgt
aactcatgttacgaacacatccaagtatctcgtgccagggagctcatgagccaacatctg
aagaaacccattgctacagcttccagttga

DBGET integrated database retrieval system