KEGG   Pteropus alecto (black flying fox): 102884660Help
Entry
102884660         CDS       T02993                                 

Gene name
CAMKK2
Definition
(RefSeq) LOW QUALITY PROTEIN: calcium/calmodulin-dependent protein kinase kinase 2
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04140  Autophagy - animal
pale04152  AMPK signaling pathway
pale04211  Longevity regulating pathway
pale04920  Adipocytokine signaling pathway
pale04921  Oxytocin signaling pathway
pale05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102884660 (CAMKK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102884660 (CAMKK2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102884660 (CAMKK2)
   04921 Oxytocin signaling pathway
    102884660 (CAMKK2)
  09149 Aging
   04211 Longevity regulating pathway
    102884660 (CAMKK2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    102884660 (CAMKK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102884660 (CAMKK2)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     102884660 (CAMKK2)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: Other
  CAMKK family
   102884660 (CAMKK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 102884660
NCBI-ProteinID: XP_015443452
Position
Unknown
AA seq 639 aa AA seqDB search
MEMPNVLQTGRIRSRCEESPCPHARAPVLRNTRRKKCRGGAAAPWECPRVSVLDEVRART
MSSCVSSQPSSDRAAPQDELGGGGGSSSEGQKPCEALRGLSSLSIRLGMESFVVVTECEP
GCTVDRGLTRDRPLEADGREVPLDAGSQARPQLSSRQLSLQERSQLDANGRCVHPVQPPS
PVGSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNT
YYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVV
KLVEVLDDPTEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKII
HRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFSGK
ALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDK
NPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPSLATVILVKT
MIRKRSFGNPFEGSRREERSFSAPGNLLLKKPTREWEPLSEPKEARQRRQLPGPRPAPRG
GGGSALVKGGKKVESWGAPAPARGPRTRMRPLWPEQAME
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggagatgccaaatgtcctgcaaacaggccggatccgcagcagatgtgaagagtcgccc
tgccctcatgcccgagcgcccgtgttgagaaacaccaggaggaaaaagtgccgtggtggc
gccgctgccccatgggagtgcccccgtgtgtccgtgttggatgaggttcgcgcacgcacc
atgtcatcatgcgtctctagtcagcccagcagcgaccgggccgccccccaggatgagctg
gggggcgggggcggcagcagcagcgaaggccagaagccctgcgaggccctgcggggcctc
tcgtccctgagcatccgcctgggcatggagtccttcgtcgtggtcaccgagtgtgagcca
ggttgcaccgtggaccgcggtctgacccgggaccggcccctggaggccgatggccgagag
gtccccctcgacgccggctcccaggcccggccccagctctccagtcgccagctgtctctg
caggagcggtcgcagctggacgcgaacggacgctgcgtccacccggtccagcccccctcg
cccgtgggctccccgcagtcgtcaccacggctgccccggcggcccacggtggagtcccac
cacgtctccatcactgggatgcaggattgcgtacagctcaatcaatacacactgaaggat
gaaattggaaagggctcctatggcgtggtcaagttggcttacaacgaaaatgacaacacc
tactatgcgatgaaggtgctgtccaaaaagaagctgatccgacaggcgggctttccacgt
cgtcccccacctcgaggcactcggccagctccggggggctgcatccagcccaggggcccc
attgagcaggtgtaccaagaaatcgccatcctcaagaagctggatcaccccaatgtggtg
aaactagtagaggtcctggatgaccccactgaggaccatctgtacatggtgtttgaactg
gtcaaccaagggcctgtgatggaagtgcccaccctcaaaccgctctccgaagaccaggct
cgattctacttccaggatctgatcaaaggcatcgaatacttacactaccagaagatcatc
caccgggacatcaaaccttccaacctgctggttggagaagacgggcacatcaagatcgcc
gacttcggcgtgagcaatgagttcaagggcagcgatgcgctcctctccaacaccgtgggc
acgcctgccttcatggcgcccgagtcactctcagaaacccggaaaatcttctctgggaag
gccttggacgtttgggccatgggtgttacgctgtactgctttgtgtttggccagtgcccg
ttcatggacgaacggatcatgtgtttacacagtaagatcaagagtcaggccctggaattt
ccagaccagcccgacatagccgaggacttgaaggacctgatcacccgcatgttggacaag
aaccccgagtcgaggatcgtggtgccggagatcaagctgcacccctgggtcacgaggcac
ggggcggagccgttgccatcggaggacgagaactgcacgctggtcgaggtgaccgaagag
gaggtcgagaattcggtcaaacacattcccagcctggcgaccgtgatcctggtgaagacc
atgatacggaagcgttccttcgggaacccgttcgaaggcagccggagggaggagcgctcg
ttttcagcgcccggaaacctgctcctcaaaaaaccaaccagggagtgggaacccctgtct
gagcccaaggaagcaaggcagcgaagacagcttcccgggccccgacccgccccccgtggg
ggaggaggaagtgctcttgtgaaaggcggcaaaaaggtggagagttggggggccccggcc
ccggcccgcggcccgcgcacgcgcatgcgccctctgtggccggagcaggcgatggagtag

DBGET integrated database retrieval system