KEGG   Pteropus alecto (black flying fox): 102884730Help
Entry
102884730         CDS       T02993                                 

Definition
(RefSeq) epididymal secretory glutathione peroxidase isoform X1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00480  Glutathione metabolism
pale00590  Arachidonic acid metabolism
pale01100  Metabolic pathways
pale04918  Thyroid hormone synthesis
pale05014  Amyotrophic lateral sclerosis (ALS)
pale05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102884730
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102884730
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    102884730
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    102884730
   05016 Huntington disease
    102884730
Enzymes [BR:pale01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102884730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 102884730
NCBI-ProteinID: XP_006908449
Position
Unknown
AA seq 221 aa AA seqDB search
MTAQLRASYLFPLLLAGFVQTNSKPEKMKMDCYKGVEGTIYEYDALTLNGKEHIPFKQYV
GKHVLFVNVATYCGLTVQYPELSTLQEELKPFGLIVLGFPCNQFGKQEPGENLEILPGLK
YVRPGGGYIPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELLGSFKHISWEPVKVHDVR
WNFEKFLVGPDGVPVMRWSHWAPVSTVKSDILEYLKQFKTK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacagctaagggcttcttatctttttccccttctcctagctggctttgttcag
acaaactccaagccagagaagatgaagatggattgctacaaaggtgtggaaggaaccatc
tatgaatatgacgccctcactcttaatgggaaagaacacattccgttcaagcagtatgtg
ggcaagcatgtcctttttgtcaatgtggccacctattgtggtctaacagttcaatatcct
gaactgagcacacttcaagaagagctgaagccatttggcctaattgtgttggggtttccc
tgcaaccaatttggaaagcaagaaccaggagaaaacttggagatccttccagggctgaag
tatgtccgtccagggggaggatatatacctaatttccagctttttgagaaaggggatgtg
aatggtgaaaaagaacagaaagtcttcacctttttgaagcattcctgtcctcacccctct
gagcttttgggctctttcaaacatatctcctgggagcctgtaaaggtccacgatgttcgc
tggaattttgaaaagttcctggtggggcctgatggagtccctgtcatgcgctggtcccat
tgggctccagtcagtacagttaagtcagatatcctggagtacctgaagcaattcaaaact
aaatag

DBGET integrated database retrieval system