KEGG   Pteropus alecto (black flying fox): 102884747Help
Entry
102884747         CDS       T02993                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale03013  RNA transport
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102884747
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pale03012]
    102884747
Translation factors [BR:pale03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    102884747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI Caenor_Her-1
Motif
Other DBs
NCBI-GeneID: 102884747
NCBI-ProteinID: XP_024904185
Position
Unknown
AA seq 913 aa AA seqDB search
MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEEL
TNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNEL
WEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITNYKQNPEQSADEDAEKNEEDSEG
SSDEDEDEDGVSAATFLKKKSEAPSGESRKFLKKLEDEDEDSEDSEDDEDWDTGSTSSDS
DSEEEEGKQTVLASKFLKKAPATEEDKKAAEKKREDKAKKKHDRKSKRLDEEEEDNEGGE
WERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQI
ASENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWQKCLDCINELMDILFANPNIFV
GENILEESENLHNVDQPLRVRGCILTLVERMDEEFTKIMQNSDLDQVENEGEDSAVLMER
LCKYIYAKDRTDRIRTCAILCHIYHHALHSRWFFVQRHHPLTKPCASPPLQSDLDQVENE
GEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQH
ADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQ
EQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRV
GERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLV
RKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQ
TVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTYGGYFRDQKDGYRKNEGYMR
RGGYRQQQSQTAY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggtttttcaccaccggttcggacagcgagtcagagtcgtccctttccggggag
gagctcgtcaccaaacctgtcgggggtaactacggcaaacaaccattgctgctgagtgag
gatgaagaagataccaagagagttgttcgaagtgccaaggacaagaggtttgaggagcta
accaaccttatccggactattcgtaatgccatgaagattcgggatgtcaccaagtgcctg
gaagagtttgagctcctgggaaaagcatacgggaaagctaagagtattgtggacaaggaa
ggtgttccccggttctatattcgcatcctggctgacctggaggactatcttaatgagcta
tgggaagacaaggaagggaagaagaagatgaataagaacaatgccaaggccttgagcacc
ctgcgccagaagatccgaaaatataaccgagattttgagtcccatattacaaattacaag
cagaaccctgaacagtctgcagatgaagatgctgagaagaatgaggaggattcagaaggc
tcttcagatgaggatgaggacgaggacggagtcagtgctgcaactttcctgaagaagaaa
tccgaagctccttctggggagagtcgcaagttcctcaaaaagctggaggatgaagatgag
gattcagaagattcagaagatgatgaagactgggacacaggctctacatcatctgattca
gactcagaggaagaagaagggaaacagactgtgctggcttcaaaattccttaaaaaggcc
cccgccacagaggaggacaagaaagcggctgagaagaaacgggaagataaagccaagaag
aagcacgataggaaatcaaagcgtctggacgaggaggaggaggacaatgaaggcggggag
tgggaaagggtccgaggtggagtgcccctcgttaaggagaaaccaaaaatgtttgccaag
ggaactgagatcacccatgccgttgtcatcaagaaactgaatgagatcctgcaggcacga
ggcaagaagggaactgatcgtgcagcccagattgagctgttacagctgctggttcagatt
gcttctgaaaacaatcttggggagggtgtcattgtcaagatcaagttcaatatcattgca
tctctctatgactacaaccccaatctggccacatacatgaagcccgagatgtggcagaag
tgcctggactgcatcaatgagctgatggacatcctgtttgcaaaccccaacatctttgtt
ggagagaacattctggaagagagcgagaatctgcataatgttgaccagccgctgcgtgtc
cgtggctgtatcctaactctggtggaacggatggatgaagaatttaccaaaataatgcaa
aattctgacctggatcaggtagaaaatgaaggcgaggactcagctgtgctgatggagaga
ttgtgcaagtacatctatgccaaggaccgcacagaccgtatccggacgtgtgccatcctc
tgccatatctaccatcatgccctgcactcccgctggtttttcgtccaacgacatcacccc
ctcaccaaaccctgtgcctcgcctcccctccagtctgacctggatcaggtagaaaatgaa
ggcgaggactcagctgtgctgatggagagattgtgcaagtacatctatgccaaggaccgc
acagaccgtatccggacgtgtgccatcctctgccatatctaccatcatgccctgcactcc
cgctggtaccaggcccgtgacctcatgcttatgagccacttacaagacaacattcagcac
gcagaccctccagtacagatcctatacaaccgcaccatggtgcagctgggcatctgcgct
ttccggcaaggcctgaccaaggatgcccacaacgccctgctggacatccagtcaagcggc
cgggccaaggagcttctgggccagggtctactgctgcgcagcctgcaggagcgcaaccag
gagcaggagaaggtggagcggcgccggcaggttcccttccacctgcatatcaacctggag
ctgctggagtgtgtttatctggtgtctgccatgctcctggagattccctacatggccgct
cacgagagtgatgcccgccgtcgcatgatcagcaaacagttccatcaccagctccgggtg
ggcgagcgacagcccttgctgggtccccctgaatcaatgagggaacatgtggtcgctgcc
tcaaaggccatgaagatgggtgactggaagacctgccacagttttatcatcaacgagaag
atgaacggcaaagtgtgggacctttttcccgaggctgacaaagtccgaaccatgctggtt
agaaagatccaagaagagtctctgcggacctaccttttcacatacagcagtgtctatgac
tccatcagcatggagacactgtctgacatgttcgagctggacctgcccaccgtgcattcc
atcatcagcaagatgatcattaacgaggaattgatggcctccttggaccagccaacgcaa
acagtggtgatgcaccgcaccgagcccactgcccaacagaacctggctctacagctggcg
gagaagctgggcagcctggtggaaaataacgagcgggtgtttgaccacaagcagggcacc
tatggtggctacttccgagaccagaaggatggctaccgcaaaaacgagggctacatgcgc
cggggtggctaccgccagcagcagtctcagacagcctactga

DBGET integrated database retrieval system