KEGG   Pteropus alecto (black flying fox): 102885597Help
Entry
102885597         CDS       T02993                                 

Gene name
ABHD6
Definition
(RefSeq) monoacylglycerol lipase ABHD6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:pale00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    102885597 (ABHD6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pale01002]
    102885597 (ABHD6)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102885597 (ABHD6)
Peptidases [BR:pale01002]
 Serine Peptidases
  Family S33
   102885597 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 FSH1 Thioesterase Ndr DLH DUF1057 Abhydrolase_5 Lipase
Motif
Other DBs
NCBI-GeneID: 102885597
NCBI-ProteinID: XP_024906530
Position
Unknown
AA seq 336 aa AA seqDB search
MDLDVVNMFVIAGGTLAIPILAFVALFFLWPSVLIKIYYWYWRRALGMQVRSARHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDVWLSIVKFLPKNLHLVCVDMPGHEGTTRSPLDDLS
IEGQVKRIHQFVECLKLNKKPFHLIGSSMGGAVAGVYAAYYPSDIGSLTLVCPFGLQYTM
ETPDLLQLEGTQNLDTIEKSHLIPSTAEEMSEMLQFFSYVRLKVPQQILQGLVDVRIPHN
NFYRKLLLELIKEESRYCLHQNMDKIKVPTQVIWGKQDQVLSASGADILAKSITNCQVEL
LENCGHSVVVEKPRKTAKFIVDFLASVYNTDNKKLD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgacgtggttaacatgtttgtgatcgcgggcgggacgctggccatcccaatc
ctggcatttgtagccttgtttttcctgtggccttcggtgctgataaaaatctattattgg
tactggaggagggcattgggcatgcaggttcgctctgctcgccatgaagactatcagttc
tgttattccttccgtggtaggcctgggcacaaaccttccatcctcatgctccatgggttc
tctgcacataaggatgtatggctcagcatcgtcaagtttcttccaaagaacctgcacttg
gtctgcgtagacatgccaggacatgagggtactacccgttctcccctggatgacctgtcc
atagaagggcaagttaagaggatacaccagtttgtagaatgcctcaagctgaacaaaaaa
ccattccacttgataggctcctctatgggcggcgctgtggctggggtgtatgctgcttac
tacccgtcagatattggcagtctgacccttgtgtgcccctttggcctgcaatacacaatg
gaaacaccagacctactacagctcgaaggaacacagaacttggataccatagagaagtcc
cacttgatcccatccactgcagaggagatgagtgaaatgcttcagttcttctcctacgtc
cgccttaaggtgccccagcagatcctgcaaggccttgttgacgtccgcatccctcacaac
aacttctatcgaaagttgcttttggaactcatcaaagaggagtcaagatactgtctccat
cagaacatggacaagatcaaggtcccaacacaggtcatctgggggaaacaagaccaggtg
ttaagtgcatctggggcagacattttggccaagtcaatcaccaactgccaagtggaactt
ctggaaaactgtgggcattcagtggtggtggagaaacccaggaagacagctaagttcatc
gtcgactttttagcttctgtgtacaacacagacaacaagaagctggactga

DBGET integrated database retrieval system