KEGG   Pteropus alecto (black flying fox): 102886073Help
Entry
102886073         CDS       T02993                                 

Gene name
CPT1A
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00071  Fatty acid degradation
pale01212  Fatty acid metabolism
pale03320  PPAR signaling pathway
pale04152  AMPK signaling pathway
pale04714  Thermogenesis
pale04920  Adipocytokine signaling pathway
pale04922  Glucagon signaling pathway
pale04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102886073 (CPT1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102886073 (CPT1A)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102886073 (CPT1A)
   04920 Adipocytokine signaling pathway
    102886073 (CPT1A)
   03320 PPAR signaling pathway
    102886073 (CPT1A)
  09159 Environmental adaptation
   04714 Thermogenesis
    102886073 (CPT1A)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102886073 (CPT1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pale03029]
    102886073 (CPT1A)
Enzymes [BR:pale01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     102886073 (CPT1A)
Mitochondrial biogenesis [BR:pale03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    102886073 (CPT1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 102886073
NCBI-ProteinID: XP_006911062
Position
Unknown
AA seq 773 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLRLSHEALKQIYLSGLHSWKKRFIRFKNGVITGVYPASPS
SWLIVVVGVMSTMYAKVDPSLGIIAKINRTLDTTGCMSSQMKNVVSGVIFGTGLWVALIV
TMRYSLKVLLSYHGWMFAEHGKLSRATKIWMCMIKVFSGRKPMLYSFQTSLPRLPVPAVK
DTVNRYLESVKPLMKEADFKRMTALAEDFAVNLGPRLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPLMVNSNYYAMDLLYVLPTHIQAARAGNAIHAILLYRRKVDREEIKPILLLGST
VPLCSAQWERMFNTSRIPGEETDTIQHIRDSKHIVVFHKGRYFKVWLYHDGRLLKPREIE
QQIQRILDDPSEPQAGEAKLAALTAGERVPWAKCRQAYFGRGKNKQSLDAVEKAAFFVTL
DETEQGYKEEDPVTSMDSYAKSLLHGRCFDRWFDKSFTFIVFKNGKMGLNAEHSWADAPI
VGHLWEYVMATDSFQLGYLEDGHCKGDTNPNIPYPTRLQWDIPEECQEVIEASLNSASLL
ANDVDFHSFPFNTFGKALIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLYREG
RTETVRSCTTESCNFVLAMEDPTQTVEQRLRLFKIASEKHQHLYRLSMTGSGIDRHLFCL
YVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFNLDKNPEYVSSGGGFGPVADDGY
GVSYILVGDNLINFHVSSKFSSPETDSHRFGKHLRQAMTDIITLFSFKSNSKK
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcccaccaggccgtggccttccagttcaccgtcaccccagacggcatcgac
ctgcggctgagccacgaggccctcaagcagatctatctgtctggactccactcgtggaag
aagaggttcatcagattcaagaatggcgtcatcacgggcgtgtacccggcgagtccctcc
agctggctcatcgtggtggtgggcgtgatgtcaacgatgtatgccaaggtcgacccctcg
ctgggaataatcgcgaaaatcaatcggaccctcgacacgaccggctgcatgtccagccag
atgaagaacgtggtcagcggcgtcatcttcggcacgggcctgtgggtggccctcatcgtc
accatgcgctactccctgaaggtgctgctgtcctaccacggctggatgttcgccgagcac
ggcaaattgagccgcgccaccaaaatctggatgtgtatgatcaaggtcttttcgggtcgg
aagcccatgttgtacagcttccagacttctctgccacgcctgccggtcccggccgtgaag
gacaccgtgaacaggtatctggaatcggtgaagcctcttatgaaggaagctgactttaag
cggatgacagctctggcagaagattttgctgtcaatctcgggccaagattacagtggtat
ctgaagttaaaatcctggtgggctaccaattatgtgagcgactggtgggaggagtacatc
tacctccgaggccggggcccgctgatggtgaacagcaactactacgccatggatctgctg
tacgtgctgccgacgcacatccaggcggcgcgcgccggcaacgccatccacgccatcctg
ctgtacaggcgcaaagtagaccgcgaggaaatcaaaccaatccttctcttggggtccacg
gtcccgctgtgctccgctcagtgggagcggatgttcaatacctcccggatcccaggcgaa
gaaacagacaccatccagcacatacgggacagcaagcacatcgtcgtgttccacaaaggg
cgttacttcaaagtctggctgtaccatgacggcaggctgctgaagccccgcgaaatcgag
cagcagatacagaggattttggacgacccgtcggagcctcaggccggggaggcgaagctg
gcggccctcactgcgggagagagagtgccctgggccaagtgtcgccaagcctatttcgga
cgtgggaagaacaagcagtccctggatgctgtggaaaaggcagcgttcttcgtgacgctg
gatgaaaccgagcaggggtacaaagaggaggacccggttacgtccatggactcctacgcc
aagtctctgctacacggcaggtgttttgacaggtggtttgacaagtcattcacgtttatc
gtcttcaaaaacgggaaaatgggcctgaacgccgagcactcctgggccgatgctcccatc
gtcggccacctctgggagtatgtcatggccactgacagctttcaactgggttatttggag
gacggacactgtaaaggtgataccaacccgaacattccataccccacccggctacagtgg
gacatcccggaggaatgccaggaggtgatagaggcgtccctgaacagcgccagcctcctg
gccaacgacgtggatttccactcttttcccttcaacacgttcggaaaagcgctgatcaag
aaatgccggacgagcccggatgcgtttgtgcagctcgccctccagctggctcattacaag
gacatgggcaaattttgcctcacgtacgaggcctccatgacccggctgtaccgagagggg
cggacggagacggtgcgttcctgtaccactgagtcgtgcaactttgtgctggccatggag
gaccccacgcaaacggttgaacagaggctccggttgttcaagatcgcatccgagaagcac
cagcatctgtaccgcctctcgatgaccggctctgggatcgaccgccatctcttctgcctt
tacgtggtatccaagtatctcgccgtggaatcccctttcctgaaggaagtcttatctgag
ccttggagactgtcaaccagccagaccccgcagcagcaggtagagctgttcaatttggac
aagaatccggagtacgtgtccagtggagggggctttgggccggtggctgacgatggctat
ggcgtgtcctacattctcgtgggagacaacctcatcaacttccacgtgtcttccaagttc
tccagccctgagacggattctcatcgctttgggaagcacctgagacaagcaatgactgac
ataatcactctgttcagcttcaagtccaattctaaaaagtaa

DBGET integrated database retrieval system