KEGG   Pteropus alecto (black flying fox): 102886268Help
Entry
102886268         CDS       T02993                                 

Gene name
HDC
Definition
(RefSeq) histidine decarboxylase isoform X1
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00340  Histidine metabolism
pale01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    102886268 (HDC)
Enzymes [BR:pale01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     102886268 (HDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102886268
NCBI-ProteinID: XP_006920435
Position
Unknown
AA seq 662 aa AA seqDB search
MMEPEEYRERGKEMVDYICQYLSTVRERRVTPDVWPGYLRAQLPESAPEDPDSWDSIFGD
IERIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVM
DWLAKMLGLPEHFLHHHPGSHGGGVLQSTVSESTLIALLAARKNKILEMKASEPGADESS
LNGRLIAYASDQAHSSVEKAGLISLVKMKFLPVDDNFSLRGEALQKAIEEDKERGLVPVF
VCATLGTTGVCAFDSLSELGPICAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFT
FNPSKWMMVHFDCTGFWVKNKYKLQQTFSVNPVYLRHANSGAATDFMHWQIPLSRRFRSL
KLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPFFEIPAQRHLGLVVFRLKGPNCLT
ESVLKEIAKAGHLFLIPATIQDKLIIRFTVTSQFTTKDDILRDWKLIRDAATLILSQHCT
SQPSPQVGNLIPQARGPIALSSRMSLQPSCRAEDDPAQTKKIIKQPQCMGANPVRREDSH
HLETLLDPLDDCFLEESPDVTKQKLSSFLFNYLSVRNKKKAVRSLSCNNVPVSAQKPVPT
DGSVKNGGSSRVRIFSRFPEEMMVLKKSAFKKLIKFYSVPSFPECSSQCGLQLPCCPLQA
MV
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgatggaacctgaagagtacagagagagaggaaaagagatggtggattacatctgccaa
tacctgagcactgtgcgggagcgacgggtgactccagacgtgtggcctggctacctgcga
gcccagctgcctgagagtgcgcccgaggaccctgacagctgggacagcatctttggggac
attgagcgaatcatcatgcctggggtggtacattggcagagcccccatatgcacgcctac
tatccagctctcacctcttggccatcactgctgggagacatgctggctgatgccatcaac
tgcttgggattcacctgggcttccagcccggcgtgcacggagctggagatgaacgtcatg
gactggctggcaaaaatgctgggactcccagagcacttcctgcaccaccaccctggcagc
catgggggaggcgtcttgcagagcacagtcagtgagtccacactgattgccttgctggca
gcaagaaagaacaaaatcctggaaatgaaagcgtctgagcctggggcggacgagtcttcc
ctgaacgggcggctcatcgcctatgcctctgaccaggctcactcttcagtggaaaaggct
ggtttgatttctcttgtgaagatgaagtttctgcctgtggatgacaacttctcgctccgc
ggggaagctcttcagaaagccatcgaggaggacaaggagaggggcttggtgcctgtcttt
gtctgtgcaacactggggaccactggggtctgtgcattcgactccctgtcagagctgggc
cccatctgtgccagggaggggctgtggctccacatcgatgccgcttatgcaggcactgcc
ttcctgtgccctgagttccgggggtttctgaagggcattgagtatgctgattccttcacc
tttaatccttccaagtggatgatggtgcactttgactgtactgggttctgggtcaagaat
aagtacaagctgcagcagactttcagcgtgaatcccgtctacctcaggcatgccaactcc
ggcgcggccactgacttcatgcactggcagatccctctgagccggcggtttcgctctcta
aagctctggtttgtgattcggtccttcggggtgaagaatcttcaagcgcacgtcagacat
ggaaccgaaatggctaaatattttgaatctctggtcagaaatgaccctttctttgaaatt
cctgcccagaggcacctaggcctggtggtttttcgtctaaagggtcctaattgtctcaca
gaaagtgtgttaaaagaaatagctaaagctggccatctcttcctcatcccggccactatc
caggacaagttgatcatccgcttcactgtgacatcccagttcaccaccaaggatgacatc
ctgagagactggaagctcattcgagatgctgctactctcattctgagtcagcattgtact
tcccagcccagccctcaggttgggaaccttattccccaagccaggggtcccatagcactg
tccagtagaatgtccctccagccttcctgtagggcagaagatgacccagcccagaccaag
aagattatcaagcagcctcagtgtatgggagccaatcccgtgagaagggaagatagccac
catcttgaaaccttgctggacccacttgatgactgctttttagaagagagcccggatgtc
accaagcaaaagctttcttccttcttgttcaattatttgtctgtgaggaataagaagaag
gcagtgcgttccctcagttgcaacaacgtgcctgtgagtgctcagaagccagtgcccacg
gatggctctgtgaagaatgggggctcctctcgggtcagaatcttctctaggtttccagaa
gagatgatggtgctgaagaaaagtgccttcaaaaaactaatcaagttctacagcgtcccc
agctttcctgaatgtagctctcagtgtgggctccagctgccctgctgccctctgcaggca
atggtttag

DBGET integrated database retrieval system