KEGG   Pteropus alecto (black flying fox): 102886561Help
Entry
102886561         CDS       T02993                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00590  Arachidonic acid metabolism
pale01100  Metabolic pathways
pale04064  NF-kappa B signaling pathway
pale04370  VEGF signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04657  IL-17 signaling pathway
pale04668  TNF signaling pathway
pale04723  Retrograde endocannabinoid signaling
pale04726  Serotonergic synapse
pale04913  Ovarian steroidogenesis
pale04921  Oxytocin signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale05140  Leishmaniasis
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05167  Kaposi's sarcoma-associated herpesvirus infection
pale05200  Pathways in cancer
pale05204  Chemical carcinogenesis
pale05206  MicroRNAs in cancer
pale05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102886561 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    102886561 (PTGS2)
   04064 NF-kappa B signaling pathway
    102886561 (PTGS2)
   04668 TNF signaling pathway
    102886561 (PTGS2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    102886561 (PTGS2)
   04657 IL-17 signaling pathway
    102886561 (PTGS2)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102886561 (PTGS2)
   04913 Ovarian Steroidogenesis
    102886561 (PTGS2)
   04921 Oxytocin signaling pathway
    102886561 (PTGS2)
  Nervous system
   04726 Serotonergic synapse
    102886561 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    102886561 (PTGS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102886561 (PTGS2)
   05206 MicroRNAs in cancer
    102886561 (PTGS2)
   05204 Chemical carcinogenesis
    102886561 (PTGS2)
   05222 Small cell lung cancer
    102886561 (PTGS2)
  Infectious diseases
   05163 Human cytomegalovirus infection
    102886561 (PTGS2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    102886561 (PTGS2)
   05165 Human papillomavirus infection
    102886561 (PTGS2)
   05140 Leishmaniasis
    102886561 (PTGS2)
Enzymes [BR:pale01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102886561 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 102886561
NCBI-ProteinID: XP_006907791
UniProt: L5KXH5
Position
Un
AA seq 604 aa AA seqDB search
MLARALVLCAALALSGAANPCCSNPCQNKGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLYLKPTPNTVHYILTHFKGVWNIVNNIPFLRNAIMKYVLTSRSHLVDSPPTYNAHY
GYKSWEAFSNLSYYTRVLPPVAHDCPTPMGVKGKKELPASEVIVEKFLLRRKFVPDPQGT
NLMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKY
QIIDGEMYPPTVKDTQVEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLRFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIEDQEYDYRQFIYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNFPAAIQYVAKASIDQSRQMKYQALNEYRKRFLMKPYESFEELTGEKEMAAELEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNAICSPHYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPSTSFSVQDPPPTKAVTIRASPSHSGLDDINPTVLLKGR
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctggcccgcgccctggtgctctgcgccgccctggcgctcagcggtgcagcaaatcct
tgctgttccaacccatgtcaaaacaaaggtgtatgtatgagtgttggatttgaccagtac
aagtgtgactgtacccgaacaggattctacggtgaaaactgttcaacacctgaatttctg
acgagaataaaattatacctgaaacccactccaaacacagtgcactacatacttacccac
ttcaagggtgtctggaacatcgttaataatattcccttcttgagaaatgcaattatgaaa
tatgtgctgacatccagatcacatttggttgacagccctccaacttacaatgcacactat
ggctacaaaagctgggaagccttttctaatctctcctattataccagagttcttccccct
gtggctcacgactgcccaactcccatgggtgtgaaagggaagaaagagcttcctgcttca
gaagtgattgtggaaaaatttctcctaagaagaaagtttgtccctgatccccagggcaca
aatttgatgtttgcattctttgcccagcacttcacccatcaatttttcaagacagatcat
aagcgaggaccagctttcaccaaaggactgggtcatggggtggatttaaatcatatttat
ggtgaaactttggatagacagcataaactgcgccttttcaaggatggaaaactgaaatat
cagataattgatggagagatgtatcctcccacagtcaaagatactcaggtggagatgatc
tatccccctcacgtccctgaacacctgcggtttgctgtggggcaggaagtgtttggtctg
gtgcctggtctgatgatgtacgccacaatttggctgcgagagcataacagagtgtgtgat
gtgcttaaacaggagcatccagaatgggatgacgagcgtttgttccagacaagcaggctg
atactgataggagaaactattaagatcgtgattgaagactacgtacaacacttgagtgga
tatcacttcaaactgaggtttgacccagagctccttttcaatcaacaattccagtaccaa
aaccgtattgctgctgagtttaacacactctaccactggcatccccttttgcctgacacc
tttcagatcgaagaccaagagtacgactatcgacagtttatctacaacaactccatatta
ctggaacatgggcttacccagtttgttgaatcattcagtaggcaaattgctggcagggtt
gctggtggtaggaattttccagctgcaatacaatatgtagcaaaggcttccatcgaccag
agcagacagatgaaataccaggctctcaatgagtaccgcaaacgctttctgatgaagccc
tatgaatcatttgaagaacttacaggagagaaggaaatggctgcggagttagaagcactt
tatggtgacattgatgccatggagctgtatcctgcccttctggttgaaaagcctcgtcca
gatgccatctttggtgagaccatggtggaacttggagcacctttctccttgaaaggactt
atgggtaatgctatatgttctcctcactactggaagcctagcacttttggtggagaagta
ggttttaaaatcatcaacaccgcctcaattcagtctctcatctgcaataatgtgaaaggc
tgtccttcgacttcgttcagtgttcaagatccaccgcccaccaaagcagtcaccattcgt
gcaagcccttcccattctggactagatgatatcaatcctacagtactactaaaaggacgt
tcaactgaactgtag

DBGET integrated database retrieval system