KEGG   Pteropus alecto (black flying fox): 102886770Help
Entry
102886770         CDS       T02993                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis protein 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
pale  Pteropus alecto (black flying fox)
Brite
KEGG Orthology (KO) [BR:pale00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102886770 (DOCK7)
Membrane trafficking [BR:pale04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    102886770 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N Elong_Iki1
Motif
Other DBs
NCBI-GeneID: 102886770
NCBI-ProteinID: XP_015450553
Position
Unknown
AA seq 2140 aa AA seqDB search
MDTAGTSVPNKSHVGPHSENVSLTVAAEVRKQISGQYSGSPQLLKNLNIVGNISHHTTVP
LTEAVDPVDLEDYLITHALAVDSGPLRDLIEFPPDDIEVVYSPRDCRTLVSAVPEESEMD
PHVRDCIRSYTEDWAIVIRKYHKLGTGFNPNTLDKQKERQKGLPKQVFESDEAPDGSSYQ
DEQDDLKRRSMSIDDTPRGSWACSIFDLKNSLPDALLPNLLDRTPNEEIDRQNDDQRKSN
RHKELFALHPSPDEEEPIERLSVPDVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDV
KEKKKISENFYFDLNSEQMKGLLRPHVPPAAITTLARSAIFSITYPSQDVFLVIKLEKVL
QQGDIGECAEPYMIFKEADATKNKEKLEKLKSQADQFCQRLGKYRMPFAWTAIHLMNIVS
SAGSLERDSTEVEISTGERKGSWSERRNSSIVGRRSLERTTSGDDACNLTSFRPATLTVT
NFFKQEGDRLSDEDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPELLQ
VKLYPDSRVRPTREILEFPARDVYVPNTTYRNLLYIYPQSLNFANRQGSARNITVKVQFM
YGEDPSNAMPVIFGKSSCSEFSKEAYTAVVYHNRSPDFHEEIKVKLPATLTDHHHLLFTF
YHVSCQQKQNTPLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGM
KWVDNHKGVFNVEVVAVSSIHTQDPYLDKFFALVNALDEHMFPVRIGDMRIMENNLENEL
KSSISALNSSQLEPVVRFLHLLLDKLILLVVRPPVIAGQIVNLGQASFEAMASITNRLHK
NLEGNDQHGRNSLLASYIYYVFRLPNTHPNSPSPGPGGLGGSVHYATMARSAVRPASLNL
NRSRSLSNSNPDISGTPTSPDDEVRSIIGSKGLDRSNSWVNTGGPKAAPWGSNPSPSAES
TQAMDRSCNRMSSHTETSSFLQTLTGRLPTKKLFHEELALQWVVCSGSVRESALQQAWFF
FELMVKSMVHHLYFNDKLDAPRKSRFPERFMDDIAALVSTIASDIFSRFQKDTEMVERLN
TSLAFFLNDLLSIMDRGFVFSLIKTCYKQVSSKLYSLPNPSVLVSLRLDFLRIICSHEHY
VTLNLPCSLLTPPASPSPSVSSATSQSSGFSTNVQDQKIANMFELSVPFRQQHYLAGLVL
TELAVILDPDAEGLFGLHRKVINMVHNLLSSHDSDPRYSDPQIKARVAMLYLPLIGIIME
TVPQLYDFTETHNQRGRPICIAPDDYESESGSMISQTVAMAIAGTSVPQLTRPGSFLLTS
TSGRQHTTFSAESSRSLLICLLWVLKNADETVLQKWFTDLSVLQLNRLLDLLYLCVSCFE
YKVSDYFERMNSLTFKKSKDMRAKLEEAILGSIGARQEMVRRSRGQLERSPSGSAFGSQE
NLRWRKDMTHWRQNTEKLDKSRAEIEHEALIDGNLATEANLIILDTLEIVVQTVSVTESK
ESILGGVLKVLLHSMACNQSAVYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRH
CSSSISTIRSHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLRRSL
KTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGY
QTSPDLRLTWLQNMAGKHSERSNHAEAAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQN
ISSNVLEESAVSDDVVSPDEEGICSGKYFTESGLVGLLEQAAASFSMAGMYEAVNEVYKV
LIPIHEANRDAKKLSTIHGKLQEAFSKIVHQSTGWERMFGTYFRVGFYGTKFGDLDEQEF
VYKEPAITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYVEPYF
DTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRV
NVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEV
AQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHR
LKEALQPLINRKIPQLYKAVLPVTCHRDSFSRMSLRKMDL
NT seq 6423 nt NT seq  +upstreamnt  +downstreamnt
atggatactgcgggcacttctgtaccaaacaagtctcatgttggccctcactccgaaaat
gtctccctaactgtggctgccgaagttaggaagcagatctctggacaatacagtggttct
ccccagctgctcaaaaacctcaacattgttggcaatatatctcatcataccacagtgccc
cttacggaagcagtggatccagtggatttggaagattacctcattactcacgcgttagct
gtggattctgggcctttaagggatttgattgaattccctccagatgatattgaagttgtt
tatagtccgagggactgtagaacacttgtttcggctgtacctgaagaaagtgaaatggat
ccacatgttagagattgtataaggagttatacagaagactgggcaattgtgatcagaaaa
tatcataaactgggaacaggatttaatcccaatacattagataaacagaaagaaaggcaa
aaaggtttgccaaaacaggtctttgaatctgatgaagctccagatggcagcagctaccag
gatgagcaagatgaccttaaaagacgttcaatgtcaatagatgatactccaaggggtagc
tgggcctgcagtatttttgacttgaaaaattcacttccggatgctctgcttcctaattta
cttgatcgaactccaaatgaagaaatagaccgtcagaatgatgatcaaaggaaatcaaac
cgtcacaaggaactctttgctttgcatccatcaccagatgaggaagaaccaatagaacga
cttagtgttcctgatgtgcccaaagaacattttggtcaaagacttcttgtaaaatgttta
tcactcaagtttgagattgaaattgaacccatttttgcaagtttagctttatatgatgtc
aaggaaaagaaaaagatttcagaaaacttttattttgaccttaattctgagcagatgaaa
ggattgttgcgtccacatgtaccacctgctgcaattaccaccctggcaagatcagctatt
ttttctatcacttatccttcccaagatgtttttcttgtaataaagctagaaaaagtccta
cagcaaggagacattggagagtgtgcagaaccatatatgatttttaaagaagcagatgcc
accaagaataaagaaaaattggagaagctgaaaagtcaagccgatcagttttgccaaaga
cttgggaaatatcgcatgccttttgcttggactgcgatccatttaatgaatattgttagc
agtgctgggagtttggaaagagattctacagaggtagaaataagcactggagaacgaaaa
gggtcttggtcagagaggaggaattctagtatcgttggtagacgatcacttgaaaggaca
acaagtggagatgatgcttgtaacttgaccagctttcgacctgctacactcactgtgacg
aatttttttaagcaggaaggagaccgcttaagtgatgaagatctgtacaaattccttgct
gatatgagaaggccatcttctgttttacggagactaagaccaattacagctcagctgaag
atagacatttctccggcacctgaaaatccccattattgcctaaccccagagctacttcaa
gtgaagctttaccctgacagtagagttagacctaccagagaaattttggagtttcctgcc
agggatgtttatgttccaaacactacttacagaaatcttctttacatataccctcagagt
ctcaattttgccaatcgtcaaggttccgctagaaatataacagtgaaagtccagtttatg
tatggggaggatccaagtaatgctatgccggtaatctttggtaaatctagctgttcagaa
ttttcaaaggaagcctatacagccgtagtatatcataacaggtctcctgattttcatgaa
gaaatcaaagttaaactccctgctactttaactgaccatcatcacttgctttttactttt
tatcatgttagttgtcaacaaaagcaaaatactcctcttgaaactcctgtgggatataca
tggataccaatgcttcagaatggacgattaaagactgggcagttttgtctaccggtctca
ttggaaaaaccaccacaggcttactctgttctgtctcctgaggttcctctacctggcatg
aaatgggtagataatcacaaaggtgtttttaatgttgaagttgttgctgtttcatctatc
catacgcaagatccttatcttgacaagttttttgctttggtcaatgctctggatgagcac
atgttcccagtccgaattggagacatgcgaatcatggaaaataacttagaaaatgaactg
aagagcagtatttcagctttgaattcatctcagctggaaccagtggtccgatttcttcat
cttctccttgataaattgatacttctagttgttagacctcctgtcattgctggccaaata
gttaatctaggtcaagcatcttttgaagccatggcatcaattacaaatcggcttcacaaa
aacttggaaggaaatgaccagcatggcaggaacagccttcttgcatcatatatctattat
gtttttcgtctaccgaatactcaccctaattcaccatcaccaggtcctgggggtttgggc
ggatcagtgcattatgccacaatggcaagatctgctgtaagacctgcaagccttaattta
aatcgttctcggagccttagtaatagtaatccagatatatctggaactcccacatcacca
gatgatgaagtacggtccatcatcggcagtaagggtttagatcgctccaattcctgggtt
aacactggtggtccaaaagctgccccatggggatccaaccccagtccaagtgcagaatca
acacaggctatggatcgaagttgtaatcgtatgtcttcgcacacagagacgtcaagtttc
ttacaaacattaacgggacgcttaccaactaaaaagctttttcatgaggagctggctttg
cagtgggttgtttgcagtggcagcgttcgggagtcggctttgcaacaagcctggttcttt
tttgagttaatggtgaagagcatggtgcaccatttatactttaatgataaacttgatgca
ccaaggaaaagtcgttttccagagcgtttcatggatgacattgctgctcttgtcagtaca
attgctagtgatatattttcaagatttcagaaggacacagaaatggttgagagactcaac
actagtcttgcattctttctcaatgatctgttgtctattatggacagaggatttgtcttt
agccttataaagacctgctataaacaggtgtcttcaaaactttattccttaccaaatcca
agtgtccttgtatccttgaggttggattttttgcgaatcatctgcagccatgagcactat
gttacattaaacttaccctgcagtttgcttactccacccgcctcaccatcaccttcggtt
tcttctgcaacatctcagagttctggattttccaccaatgtacaagaccagaagattgca
aatatgtttgaattatctgtacctttccgccaacagcattatttggcaggacttgtgtta
acagagcttgctgttattttagatcctgatgcagaaggactgtttggattgcataggaaa
gtcatcaatatggtacacaatttactatccagtcatgactcagacccacggtactctgac
ccccagataaaggctcgggtggccatgttgtatctacctctgattggcattatcatggaa
actgttcctcagctgtatgattttacagaaactcacaatcaacgagggagaccaatttgt
atagcccctgatgattatgaaagtgagagcggaagcatgataagccagacggttgccatg
gcaattgcaggaacatcagttcctcaactaacaaggcctggcagtttcctcctcacatca
acgagtggcaggcaacacactaccttttcggcagaatcaagtcgaagccttttgatctgt
ctactttgggttctcaagaatgcagatgagacagttctacaaaagtggtttacagatctc
tcagtcctgcaactaaacaggctattagacctgctttatctctgtgtatcctgctttgaa
tacaaagtaagtgattattttgaaagaatgaatagtttgacctttaagaaatcaaaagac
atgagagcaaagcttgaagaagctattcttgggagcataggtgctaggcaagaaatggtg
cgcagaagccgaggacagcttgagagaagcccatctggaagtgcctttggaagtcaggag
aatctgaggtggagaaaggatatgactcactggcgtcaaaacactgaaaagcttgacaag
tcaagagcggagattgaacatgaagcactgattgatggaaatctggctactgaagcaaac
ctcatcatcttggatacattagagattgttgtccagacagtttctgtaacagaatccaaa
gagagcatccttggtggggtgctaaaagtgctactccatagcatggcctgtaaccaaagt
gcagtttatctacaacactgttttgctacgcaaagagctctggtttcaaagttcccagaa
ctcctgtttgaagaagagacagagcagtgtgctgatctatgccttcggcttctccgacac
tgtagcagtagcatcagtacaatacggtcacacgctagtgcctccctttacctactgatg
aggcagaactttgaaattgggaataactttgccagggtgaaaatgcaagtaaccatgtcg
ctatcttccttggtgggcacatctcagaattttaatgaagaattcttaagacggtctcta
aagactatattgacatatgctgaagaagatctggaattgagggaaacaacctttcctgat
caggtccaagatttggttttcaatctccatatgatcctttctgatactgttaaaatgaag
gaacaccaggaggatcctgaaatgttgatcgatctaatgtacagaattgccaagggctac
cagacctctccagacctgcggttgacctggttgcagaacatggctggcaaacactcagaa
cgcagcaaccatgccgaagctgcgcagtgcctggtccactcggcagcacttgttgctgaa
tatttgagcatgctagaggaccggaagtatcttcctgtgggttgtgtaacgtttcagaat
atttcatctaatgttttagaagagtctgcagtctcagacgacgtggtatctccagatgaa
gaaggtatctgctctggaaagtactttactgagtcaggacttgtgggattactggaacaa
gcagctgcttctttctctatggctggtatgtatgaagcagttaatgaggtttacaaagta
cttattcctattcatgaagctaatcgggatgcaaagaaactatccacgattcatggtaaa
cttcaagaagcattcagcaaaattgttcatcagagtactggctgggagcggatgtttggc
acctattttcgtgttggtttttatggaaccaagttcggggatttggatgaacaggaattt
gtttacaaggagcctgcaataactaaacttgcagagatatctcacagattggagggcttt
tatggagaaagatttggagaggatgttgttgaagttatcaaggattctaatcctgtagac
aagtgtaaattagatccgaacaaggcatatattcagattacctatgtggagccatacttt
gacacatatgagatgaaggacagaatcacatattttgacaaaaattataatcttcgccgt
ttcatgtactgtacacccttcactttagatgggcgtgcccacggtgagcttcatgaacag
ttcaaacggaagaccattctgactacttctcatgcttttccttatattaaaacaagggtc
aatgtcactcacaaagaggagatcatcttaacaccaattgaagttgctattgaagacatg
cagaaaaagacacaggagttggcatttgcaacacatcaggatcccgcagatcccaaaatg
cttcagatggtactccagggatctgtaggcacaacagtgaatcaagggcctttggaagtt
gcccaggttttcctatctgaaatacccagtgacccaaaactcttcagacatcataataaa
ttgcgactctgcttcaaagattttactaaaaggtgtgaagatgccttaagaaaaaataag
agcttaattggaccagatcaaaaagaatatcaaagggaactggagagaaactatcatcgc
cttaaagaggccctacagcctctgataaacagaaagatccctcagttatacaaggcagta
ttacctgtcacctgccacagagattccttcagtcgaatgagcctgcgcaaaatggatctc
taa

DBGET integrated database retrieval system