KEGG   Pteropus alecto (black flying fox): 102888274Help
Entry
102888274         CDS       T02993                                 

Definition
(RefSeq) cytosolic phospholipase A2 beta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00564  Glycerophospholipid metabolism
pale00565  Ether lipid metabolism
pale00590  Arachidonic acid metabolism
pale00591  Linoleic acid metabolism
pale00592  alpha-Linolenic acid metabolism
pale01100  Metabolic pathways
pale04010  MAPK signaling pathway
pale04014  Ras signaling pathway
pale04072  Phospholipase D signaling pathway
pale04217  Necroptosis
pale04270  Vascular smooth muscle contraction
pale04370  VEGF signaling pathway
pale04611  Platelet activation
pale04664  Fc epsilon RI signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04724  Glutamatergic synapse
pale04726  Serotonergic synapse
pale04730  Long-term depression
pale04750  Inflammatory mediator regulation of TRP channels
pale04912  GnRH signaling pathway
pale04913  Ovarian steroidogenesis
pale04921  Oxytocin signaling pathway
pale05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102888274
   00565 Ether lipid metabolism
    102888274
   00590 Arachidonic acid metabolism
    102888274
   00591 Linoleic acid metabolism
    102888274
   00592 alpha-Linolenic acid metabolism
    102888274
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102888274
   04010 MAPK signaling pathway
    102888274
   04370 VEGF signaling pathway
    102888274
   04072 Phospholipase D signaling pathway
    102888274
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102888274
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102888274
   04664 Fc epsilon RI signaling pathway
    102888274
   04666 Fc gamma R-mediated phagocytosis
    102888274
  09152 Endocrine system
   04912 GnRH signaling pathway
    102888274
   04913 Ovarian steroidogenesis
    102888274
   04921 Oxytocin signaling pathway
    102888274
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102888274
  09156 Nervous system
   04724 Glutamatergic synapse
    102888274
   04726 Serotonergic synapse
    102888274
   04730 Long-term depression
    102888274
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102888274
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102888274
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102888274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 102888274
NCBI-ProteinID: XP_015451335
Position
Unknown
AA seq 812 aa AA seqDB search
MALASRVASASPLALVSLGPFSFRSLSLSLQAKVPGTCLLTVRVLQARGLPSKDLVTPSD
CYVTLWLPTASSCRLQTRTVRNSRNPIWNQSFRFRIHSLLKNILQLQVFDQDLLTSDDPV
LSVLFDVGTLRVGEFRSESFTLSPQGEQQLEVEFRLQNLTDRAEQLFSNGILVARELSCL
HVRLEEAGDQQGSEGKVRLVVPGSCEGPQEATVGAGSFRFHCPGCWEPELSVHLQDASQE
QLKVPLRALPSGQVVRLVFPMSQEPLMRVELKKEEGPRELAVRLGCGPCAEEQAFLSRRK
QVVAKALKQALQLDGDLQDDEIPVVAVMATGGGVRAMTSLYGQLAGLRELGLLDCITYIT
GASGSTWALANLYEDPEWSQKDLAGPIELLKTQVTKSKLGALAPSQLQRYRQEMAERAHL
GHPTCFTDLWALINEALLHDEPNDHKLSDQQKALSHGQNPLPIYCALNTKGKNMTTFEFG
EWCEFSPYEVGFPKYGAFIPSELFGSEFFMGRLTKQLPESRICFLEGIWSNLYAASLQDS
LYWASEPNQFWDRWAQDRASLDKEQVPLLKIEETPTTAGRIAEFFTDLLTWRPLAQATHN
FMRGLHFHKDYFQHPHFSTWKATKLDGSPNQLTPAESHLCLLDVGYLINTSCPPLLRPTR
DVDLILSLDYNLHGAFQQLQLLGRFCQEQKIPFPPISPSPEEQRQPQECHLFLHPDCPEA
PAVLHFPLVNDSFREHSAPGVPRTAEEKEAGEVNLSSSSSPYHYSKVTYSQEDVDKLLHL
THYNICNNREQLLEALREAVLRRRQRRQLQPQ
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atggctctggcctcgagggttgcctcagcctcccctttggcccttgtctccttgggccca
ttttccttcagaagcctgtccctctctctgcaggcaaaggtgcctgggacctgcctgctc
accgttcgtgtcctgcaggcccgtggcctgccctccaaggacttagtgaccccctctgac
tgctatgtgactctgtggctgcccacggcctccagctgcaggctgcagacacgcacagtt
aggaacagcagaaaccccatctggaatcagagctttcgcttccgaatccacagcctgctc
aagaatatcctacaactgcaagtctttgaccaggaccttttgaccagtgatgaccccgtg
ttgtcggtgctgtttgatgtaggaactttgagagttggggagttccgcagtgagagcttc
accctaagccctcagggtgagcagcagctggaagttgaatttcggctgcagaatctaaca
gaccgtgctgagcagctcttcagcaatggcatcctggtggcccgggagctttcctgcttg
cacgttcgactggaggaggcaggggaccagcagggctcagaaggcaaagttcgccttgtg
gtccctgggtcctgtgagggtcctcaggaagccacagtgggcgctggctccttccgcttc
cactgcccaggctgctgggagccggagctgagtgttcatttgcaggatgcctcccaggag
caactgaaggtacccctcagggctctgccctctggtcaagtggttaggctcgtcttccct
atgtcccaggagcccctgatgagggtggagctgaaaaaagaagaaggaccgagggagctg
gccgtgcggctgggctgcgggccctgtgcggaggagcaggccttcctgagcaggaggaag
caggtggtggccaaggccctgaagcaggccttgcagctggatggagacctgcaggacgac
gagatcccagtggtagcagttatggccactggtggtggggtccgtgcgatgacttctctg
tatggacagctggctggcctgagggagctgggcctcttggattgcattacctacatcaca
ggggcctcagggtccacttgggctttggccaacctctatgaagacccagagtggtctcag
aaggacctggcagggcccattgagttgctgaagacccaggtgaccaagagcaagctgggc
gcgctggcccccagccagctgcagcgataccggcaggagatggctgagcgtgcccacctg
ggccacccaacctgcttcactgacctgtgggccctcatcaatgaggcactgctgcatgat
gagcccaatgaccacaaactctcagaccagcagaaggctctgagtcatggccagaaccct
ctgcccatctactgtgccctcaacaccaagggcaagaacatgaccaccttcgaatttggg
gagtggtgtgagttctctccctatgaagttggctttcccaagtatggtgccttcattccc
tccgagctctttggctctgagttcttcatgggacgcctgacaaagcaacttcctgagtcc
cgcatctgcttcctggaaggtatctggagcaacttgtatgcagccagcctccaggacagt
ttatactgggcctcagagcccaaccagttctgggaccgctgggcgcaggatcgggccagc
ctggacaaggagcaggtcccccttttgaagatagaagaaactcccacaacagctggcagg
atagctgagtttttcactgaccttctgacgtggcgcccactagcccaggccacccacaac
ttcatgcgtggcctccatttccacaaggactatttccagcatcctcacttctccacctgg
aaagccaccaaactggatgggtcccccaaccaactgacacctgctgagtcccacctttgt
ctgctggatgtcggctaccttatcaacaccagctgcccgcctctcctgcggcccacacgg
gacgtggacctcatcctgtcgctggattacaacctccacggagcctttcagcaattgcag
ctcctgggccggttctgccaggagcagaagatcccattcccacccatctcaccgagccct
gaggagcagcgccagcctcaggagtgtcacctgttcttgcaccccgactgccctgaagcc
cctgctgtgctacacttccccctggtcaatgactccttccgggagcactcggcccctggg
gtcccacggacagctgaggagaaagaggctggggaggtgaacctctcttcctccagctct
ccttaccactactcgaaggtgacctacagccaggaggatgtggacaagttgctccacctg
acacattacaatatctgcaacaaccgggagcagctgctggaggccctgcgtgaggctgtg
ctgcggcggaggcagcgcaggcagctccagccccagtga

DBGET integrated database retrieval system