KEGG   Pteropus alecto (black flying fox): 102889617Help
Entry
102889617         CDS       T02993                                 

Gene name
NT5C3B
Definition
(RefSeq) 7-methylguanosine phosphate-specific 5'-nucleotidase isoform X1
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00230  Purine metabolism
pale00240  Pyrimidine metabolism
pale00760  Nicotinate and nicotinamide metabolism
pale01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102889617 (NT5C3B)
   00240 Pyrimidine metabolism
    102889617 (NT5C3B)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    102889617 (NT5C3B)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     102889617 (NT5C3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UMPH-1 HAD
Motif
Other DBs
NCBI-GeneID: 102889617
NCBI-ProteinID: XP_006924690
UniProt: L5JRW6
Position
Unknown
AA seq 373 aa AA seqDB search
MLLECRGPRPPGRSEAASGPSRPGCTTPGSRRTWPGRSPCSAPRTLARPRSVARANPGLP
LGPARCRGQSFSRVSGQVSILMKATVLMRQPGRVQEIVGALRRGGGDRLQVISDFDMTLS
RFAYNGKRCPSSHNILDNSKIISEECRKELKALLHHYYPIEIDPHWTIKEKLPHMVEWWT
KAHSLLCQQKIQKFQIAQVVRESNAMLREGYKMFFNTLYQNSIPLFIFSAGIGDILEEII
RQKQVFHPNIHVVSNYMDFDKDGFLQGFKGQLIHTYNKNSTVCENSGYFQQLQGKTNILL
LGDSMGDLTMADGVLGVENILKIGFLNDKVEEQRERYMESYDIVLEKDESLDVVNGLLQH
ILHQGDWVEMRVP
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcttctggagtgccgcgggccccgaccccccgggcgttccgaggccgccagcgggccg
tctcggcccggctgcaccaccccgggcagtaggcgcacctggcctggccggagcccctgc
tccgcccctcgcacccttgcccggcctcgcagcgttgcccgagcgaaccccggtctcccc
ttgggcccagcgcggtgccggggtcagtcgttctctcgggtttcgggacaggtgagcatc
ctgatgaaggccacggtcctgatgcggcagcccgggcgggtgcaggagatcgtgggcgcc
cttcgcaggggcgggggagaccgcttacaggtcatttctgattttgacatgaccttgagc
aggtttgcttataacggaaagcgatgcccttcttcccacaatattctggataatagcaag
atcatcagtgaggagtgccggaaagagctgaaagcgctccttcaccactattacccaatt
gagattgacccacactggaccatcaaagagaagttacctcatatggtagaatggtggacc
aaagcgcacagtctcttgtgtcagcagaaaattcagaagtttcagatagcccaggtggtt
agagagtctaacgcaatgcttagggaagggtacaagatgtttttcaacaccctctaccaa
aacagcattccgcttttcatcttttctgcgggcattggcgatatcctggaagaaattatc
cggcagaagcaggtgttccaccccaacatccacgttgtgtctaactacatggattttgac
aaagatggtttcctacaggggttcaagggccagctgatacacacatacaacaagaacagt
actgtgtgcgagaactccggttacttccagcagcttcagggcaaaaccaacatcctcctg
ctgggagactccatgggggacctcacgatggctgatggagttctaggcgtggagaacatt
ctcaagattggcttcctaaatgacaaggtggaggagcagcgggagcgctacatggagtcc
tatgacattgtgctggagaaggatgagtcgctggatgtggtcaacgggctgctgcagcac
atcttgcaccagggagactgggtggagatgcgtgtcccctga

DBGET integrated database retrieval system