KEGG   Pteropus alecto (black flying fox): 102890176
Entry
102890176         CDS       T02993                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00230  Purine metabolism
pale00240  Pyrimidine metabolism
pale01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102890176 (DCK)
   00240 Pyrimidine metabolism
    102890176 (DCK)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102890176 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 AAA_33
Other DBs
NCBI-GeneID: 102890176
NCBI-ProteinID: XP_006917354
Position
Unknown
AA seq 260 aa
MATPPKRSCLSPVTSSEGTHIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPIARWCN
VQSVQDEFQELTTSQKSGGNVLQMMYEKPERWSYTFQSYACLSRIRSQLASLNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWLNNQFGQSLELDGIIYLRA
TPEKCLSRIYLRGRNEEQGIPLEYLEKLHSKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKHDSLVERVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccaccgaagaggagctgcctatctcctgtgaccagctccgaggggactcac
atcaagaaaatttccatcgaagggaacatcgctgcagggaagtcaacgtttgtgaatatc
cttaaacaagtctgcgaggattgggaagtggttcctgaacctattgccagatggtgcaat
gttcaaagtgttcaagatgaatttcaggaactgacaacatctcagaaaagtggtgggaat
gttcttcagatgatgtatgagaaacctgaacgatggtcttataccttccagtcatatgcc
tgcctcagccgaatacgatctcagcttgcctctctcaatggcaagctcaaagatgcagag
aaacctgtattattttttgaaagatctgtgtatagtgacaggtatatttttgcatccaac
ttgtatgaatctgactgcatgaatgaaacagagtggaccatttatcaagactggcatgac
tggttgaataaccagtttggccaaagccttgaactggatggaatcatttatcttcgagcc
actccagagaaatgcttgagtagaatatatttacggggaagaaacgaagaacaagggatt
cctcttgaatatttagagaagcttcactctaagcatgaaagctggctcctgcatagaaca
ctgaaaaccaactttgattatctacaagaggtgcctatcttaacactggatgttaatgaa
gactttaaagacaaacatgacagtctggttgaaagggtcaaagaatttttgagtactttg
tga

DBGET integrated database retrieval system