KEGG   Pteropus alecto (black flying fox): 102890960
Entry
102890960         CDS       T02993                                 

Gene name
RDH5
Definition
(RefSeq) LOW QUALITY PROTEIN: 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102890960 (RDH5)
Enzymes [BR:pale01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     102890960 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 Apo-CIII
Other DBs
NCBI-GeneID: 102890960
NCBI-ProteinID: XP_024900489
Position
Unknown
AA seq 314 aa
MWLPLLLGVLLWVALWVLRDQRSLPPSDAFVFITGCDSGFGRLLALRLDQRVFRVLASCL
TPSGAEDLQRVAXDTLLDVTDLQSVQQATKWVETHVGETGLFGLVNNAGVAGMSGPTPWL
ARNDFHEVLNVNTLGPISVTLALLPLLQQARGHVVNITSIAGRLAVFGGGYCVSKFALEA
FSDTLRRDVTPFGVRVSIIEPGFFRTSITKPESLGSTLSAYWARLPPATQACYGEAFLTK
YLKVWKRFLNLICDPDLTKVSRCVEHALTARHPRTRYSPGWDAKLLWLPASYLPASLVDA
VLTWVFPKPAQAVY
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtggctgcccctactgctgggagtcttgctctgggtagcactgtgggtgctcagagac
cagcggagcctgcccccaagcgacgccttcgtcttcatcactggttgtgattcaggcttc
gggcggcttctggcactgagactggatcagagagtcttccgagtgttggccagctgcctg
accccatcaggggcagaggacctacagcgggtggccnntgacaccctactggatgtcact
gatctccaaagtgtccagcaggcaaccaagtgggtagaaacacatgttggggaaacaggg
ctttttggtctggtgaataatgctggtgtggctggtatgtctgggcccacaccgtggctg
gcccggaatgacttccatgaggtgctgaatgtgaacacactgggccccatcagcgtcacc
cttgccctgctacccctacttcaacaggcccggggccacgtggtgaacatcaccagcatc
gcgggtcgcttggcagtctttggtgggggctactgtgtctccaagtttgccctggaggcc
ttctcagacaccctgaggcgggacgtcactccttttggggtacgagtctccatcatagaa
cccggcttcttccgaacttctataacaaaaccggagagtttagggagtaccctgtcagcc
tactgggcacggctgcctccagccacgcaagcctgttatggggaggccttcctcaccaag
tacctgaaagtgtggaagcgcttcctgaacctgatctgtgacccggacctgaccaaggtg
agcaggtgcgtggagcatgccctgactgctcgtcaccccagaactcgctacagtccaggc
tgggatgccaagctgctctggctgccagcctcctacctgccagccagcctggtggatgct
gtgctcacctgggtctttcccaagcctgcccaggcagtctactga

DBGET integrated database retrieval system