KEGG   Pteropus alecto (black flying fox): 102891375
Entry
102891375         CDS       T02993                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
pale  Pteropus alecto (black flying fox)
Brite
KEGG Orthology (KO) [BR:pale00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pale01002]
    102891375 (ERAP1)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     102891375 (ERAP1)
Peptidases and inhibitors [BR:pale01002]
 Metallo peptidases
  Family M1
   102891375 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 102891375
NCBI-ProteinID: XP_006913298
Position
Unknown
AA seq 942 aa
MIFLPVKWPLGTRSYLFSSLLILLTASTSSWCRGTETTSPKASNGTPFPWNKMRLPEHII
PVHYNLMIHANLTTLTFEGTTAVEITVNQPTSAIILHSNHLQISKATLKNGAGERQSEEP
LRILEYPPHEQIALLAPEPLVIGLPYTVVIDYAGNLSENFHGFYKSTYRTKEGEVRILAS
TQFEPTAARMAFPCFDEPAFKASFSVKIRREPRHFAISNMPLVKSVIVAEGLIEDHFDVT
VKMSTYLVAFIISDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSI
PYPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMIVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFFGKCFNAMEVDALNSSHPV
STPVENPAQIREMFDDVSYEKGACILNMLRDYLGAEAFKNGIIQYLQKYSYKNTKNEDLW
NSMASICPTDSAQRMDGFCSRSHRSSLSSHWQQEGLDVKTMMNTWTLQKGFPLITITVRG
RNVHMKQEHYMKGADDTTETGYMWHVPLTFITSKSDSTHRFLLKTKTDVLILPEEVEWIK
FNVGMNGYYIVHYEDDGWDSLTGLLKETHTAISSNDRASLINNAFQLVSIGKLPIEKALD
LTLYLKHETEIMPVFQGLDELIPMYKLMEKRDMNEVETQFKAFLIRLLRNLIDKQTWTDD
GSVSERMLRSQLLLLACVRRYQPCVQRAEGYFREWKEANGNLRLPSDVTLAVFAVGAQTS
EGWDFLYKKYQSSLSNTEKNQIEFALCSSQNKEKLQWLLDQSFKGDIIKTQEFPDILRVI
GRNPVGYPLAWQFLRENWNKLVEKFELGSSSIAYMVIGTTNQFSTRARLEEVKGFFSSLK
ENGSQLRCVQQTIETIEENIRWMDKNFDKIRLWLQNQEPELL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atgatatttctgcccgtgaaatggccacttggaaccaggtcatatctattctcttcactg
ttgattctcttaactgcatcaacttcttcctggtgtcgggggactgaaactacatctcca
aaggctagtaatggaacaccatttccttggaataaaatgcgacttcccgagcacatcatc
ccagttcattataatctcatgatccacgcaaatctcaccactctgacttttgagggaacc
acagcagtagaaatcacagtcaaccagcctactagtgccatcatcttgcatagtaaccac
ctgcaaatatctaaggccaccctcaagaatggagctggagagaggcagtctgaagaacca
ctgagaatcctggaatacccacctcatgagcaaatcgcacttctggctcccgagcctctg
gttattgggctcccatacacagttgtcattgattatgctggcaatctttctgagaatttt
catggattttataaaagcacctacagaaccaaggaaggggaagtgaggatacttgcatca
acacagtttgaacctactgcagccagaatggcctttccctgctttgatgaacctgccttc
aaagcaagtttttcagtcaagatcagaagggagccaaggcactttgccatctccaatatg
ccattggttaaatctgtgattgttgctgaaggactcatagaagaccattttgatgtcact
gtgaagatgagcacctacctggtggccttcattatttcagattttaagtctgtcagcaag
atgaccaagagcggagtcaaggtttctgtgtatgctgtgccagacaagataaaccaggca
gattatgcactggatgctgcagtgactcttctagaattttacgaggattattttagcatt
ccatatcccttacccaaacaagatcttgctgctattcctgactttcagtctggtgctatg
gaaaactggggactgacaacatatagggaatctgcactattgtttgatgctgaaaagtct
tctgcatccagtaagcttggcatcacgatgattgtgtctcatgaactcgcccaccagtgg
tttgggaatctggtcaccatggaatggtggaatgatctttggctaaacgaaggatttgcc
aagtttatggagttcgtatctgtcagtgtgactcatccagaactgaaagttgaagattat
ttctttggcaagtgttttaatgcaatggaagtagatgcattgaattcctcacaccctgtg
tccacacctgtagagaatcctgctcagattcgggagatgtttgatgatgtttcttatgaa
aagggagcttgtattttgaatatgctaagggattatcttggtgccgaggcatttaaaaat
ggtattatacagtacctccagaagtatagctataaaaacacaaaaaacgaggacctgtgg
aatagtatggcaagtatttgccctacagatagcgcacagaggatggatggcttttgctct
agaagtcatcgttcatccttatcctcacactggcagcaggaaggccttgatgtgaagacc
atgatgaacacctggacactgcaaaagggctttcccctgataaccatcacagtgagaggg
aggaatgtacacatgaagcaagagcactatatgaagggagctgatgacactacagaaact
gggtatatgtggcatgttccattaacgttcatcaccagcaaatcagactccacccataga
tttttgctgaagacaaaaacagatgtgctcatcctcccagaagaggtggaatggatcaaa
tttaatgtgggaatgaatggctattacattgtgcattatgaggatgatggatgggattct
ttgactggccttttaaaagaaacacacacagcaatcagcagtaatgatcgagccagtctc
attaacaatgcatttcagcttgtcagcattggaaagctgccaattgaaaaagccttggat
ttaaccttgtacttgaaacatgaaactgaaattatgcccgtgttccaaggtttggatgag
ctgatacctatgtataagttaatggagaaaagagatatgaatgaagtggaaactcaattc
aaggcctttctcatcaggctgctgaggaacctcattgataaacagacttggactgacgat
ggctcagtctcagagagaatgctgcggagtcagctcctcctccttgcctgtgtgcgcagg
tatcagccctgcgtgcaaagggcagaaggctatttcagagagtggaaggaagccaatgga
aatttgagactgcccagtgatgtgaccttggcagtgtttgctgtgggggcccagacctct
gaaggatgggattttctttataagaaatatcagtcttctttgtccaatacagagaaaaac
caaattgaatttgccctctgtagtagccaaaataaggaaaagcttcagtggctactagac
caaagttttaagggagatataataaaaactcaagagtttccagatattcttagagttatt
ggtagaaacccggtgggatatccactggcctggcagtttctgagggaaaactggaataaa
cttgtagaaaagtttgaacttggctcgtcttccatagcctacatggtaataggaacaaca
aatcaattctccacaagagcacggcttgaagaggtaaaaggattcttcagctctttgaaa
gaaaatggttctcagctccgttgtgtccaacaaacaattgaaaccattgaggaaaacata
cgttggatggataagaattttgataaaatcagactgtggctccaaaaccaagaacctgaa
ctgctgtaa

DBGET integrated database retrieval system